KEGG   Dictyoglomus thermophilum: DICTH_1594Help
Entry
DICTH_1594        CDS       T00774                                 

Definition
endo-1,4-beta-xylanase A (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
dth  Dictyoglomus thermophilum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1535890..1536564)
Genome map
AA seq 224 aa AA seqDB search
MCKKLFSILLVLGFVFIIAGCTPKETAVQTTVPQEAVKEVAKEVPNVPNAILITTFESGK
TEGWTPNGEGVSVAVVDKDAHTGKYSLYVTGRTAGWNGAQIQLKDILKPGKVYSISVWVK
HNSDLPQHVGITMRRKYDSDSSTQYDWIKHDNEVPGGKWVELAGTYQIPAGVNILDLALY
VEIPSNPNLDFYIDDVVIVEGKQGFRITPEIFDLFAKYFRTYLN
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaaaagctttttagcatccttttagtgttaggatttgtttttataattgctggt
tgtactcctaaagagactgctgtacaaactactgtacctcaggaagctgtaaaggaagta
gcaaaggaagttcctaatgtgcctaatgctattcttatcactacttttgaatctggaaag
actgaagggtggactcctaatggagagggagtgtctgtagctgtagtggataaagatgct
catacagggaaatatagcttatatgtcacaggaagaaccgcaggttggaacggggctcaa
attcaattaaaagatattttgaaaccaggtaaggtttatagtatatctgtatgggtaaaa
cataattcagatttaccacagcatgttggtattacaatgagaagaaaatatgacagtgat
agtagtactcaatatgattggataaagcatgacaatgaggtgccaggtggtaaatgggta
gagcttgcagggacttatcagatacctgctggggttaatatacttgacttagctttatat
gtagagatccccagtaatcccaatcttgatttttatattgatgatgtggtaatagtggaa
ggaaaacaaggctttagaataactcctgagatttttgatttgtttgcaaaatattttaga
acttatttaaactaa

DBGET integrated database retrieval system