KEGG   Dictyoglomus thermophilum: DICTH_1638Help
Entry
DICTH_1638        CDS       T00774                                 

Definition
alpha-glucosidase (EC:3.2.1.20)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
dth  Dictyoglomus thermophilum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    DICTH_1638
  Lipid metabolism
   00561 Glycerolipid metabolism
    DICTH_1638
   00600 Sphingolipid metabolism
    DICTH_1638
Enzymes [BR:dth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     DICTH_1638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1588290..1589690)
Genome map
AA seq 466 aa AA seqDB search
MKIAIVGAGSIRFSLQIIGDIAKTPELSGSLISMIDVHEERLNASYILAKKYVEEIGADL
RFEKTKRLEEGIEGADFIINTALPFPEGHEDGFIKYDIVTQIGEKHGYYRGIDSQELNMV
STYTYVLISYYDLKLAIDIAKAMKKYAPSSWLLQTANPVFEITQLLNRLTDINVVGICHG
FHGVYEVFNSLRLDPKEVDWQVAGVNHGIFLNRFLYRGKNAYPLLDEWIEKESQNWEPKN
PWDLQMSPAVMDMYKFYGMLPIGDACRNGTWKYNYNLETKKKWYGKFGGIDNEIERPKFH
EELRKGRKRMIEIAKEVEKDKSIKLMEIWPELFNKDKLSGEQHIHFIKSITGKGKSRLIL
NIPNRGTLSGIPDDVVVEVPVWVDETGIKPEKIEPDLTHRIKIFYLMPRILRMEWALEGF
ISKDIKVLEEILVRDPRTKSYEQVLAVLDEILTQPFNKELREYLNY
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagctattgtaggggcaggaagtattagattttctttacaaatcattggtgat
attgctaagacacctgaattaagcggatctttgatatctatgatagatgtacatgaggaa
agattaaatgcttcttatattcttgctaagaaatatgtggaagaaattggggctgatctg
aggtttgaaaagactaagagacttgaggagggcatcgaaggagcagattttattataaat
actgctcttccttttcctgagggtcatgaagatggatttataaagtatgatatagttacg
cagattggagaaaagcacggttattacagggggattgacagtcaggaattgaatatggtc
tcaacttacacttatgtattgatttcttattatgatctgaagcttgctattgatatagca
aaggctatgaaaaaatatgctccatcttcatggcttctccagactgctaatcctgttttt
gaaattacccaacttttaaataggttaacggatattaatgtggtgggaatatgtcatggc
tttcatggagtatacgaagtatttaactctttgagattagatccaaaagaggtagattgg
caagttgctggagttaaccatggaattttccttaatagatttttatatagaggtaagaat
gcttaccctcttcttgatgaatggattgaaaaggagtctcaaaattgggagcctaagaat
ccatgggatcttcagatgagtcctgcggttatggatatgtacaaattttatggaatgctc
cccataggggatgcctgtaggaatggaacatggaagtacaactacaatcttgagactaaa
aagaaatggtatgggaagtttggaggtattgataatgagatagaaaggcctaaatttcat
gaagagctaagaaagggtaggaagagaatgattgaaattgctaaagaggttgagaaggat
aaaagtataaagttaatggaaatatggcctgagttatttaataaagataaattaagtggt
gaacagcatatacattttataaaaagtattactggaaaaggcaaatcaagattaatattg
aatattcctaatagaggtaccctatcaggtattcctgacgatgtagtggtagaagtgcct
gtatgggtagatgaaactgggataaagcctgaaaagatagagcctgatcttactcatagg
ataaaaatcttctacttaatgccaagaattttaagaatggaatgggctttagaagggttt
atctctaaagatataaaagtacttgaggagatattagtaagagatcctaggactaagtct
tatgaacaggtgcttgctgttttagacgagattttgacacagccttttaataaagagctt
agagaatacttgaattactga

DBGET integrated database retrieval system