KEGG   Dictyoglomus thermophilum: DICTH_1679Help
Entry
DICTH_1679        CDS       T00774                                 

Definition
protein kinase
Orthology
K08884  
serine/threonine protein kinase, bacterial [EC:2.7.11.1]
Organism
dth  Dictyoglomus thermophilum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1636178..1638169)
Genome map
AA seq 663 aa AA seqDB search
MRRILIKFGLLFGFFILLLILSNLNFFKVWEKQTVDLRFHLRGEINPYKDIVIIGIDDDS
ILELGNWPWRRDIHAKLIDVLRKEKPKIIVFDVLFDTATPFDAILAEKIKSAGNVVLSGY
LQTYFDKRLKINVVSLREPVEILKNSALGSGYSNLYIDEDNKVRRVRIYENSGSVKYYSL
ALVAYKFISKKDFSSLTLTLPSDFYINFRGGEGTYRVYSYVNVLRGNFPKNTFRDKIVLV
GAVSPALKDLFLHPFSGFSSKLGINYSYMPGVEIHANIIDNLFMRDFFTNIFPPFVLIIN
FLSIFLPGVLFGRRIILNLFLTFLFIFLYFMFSYQAFINRVLLPLVSPSVGFVFSFLGNL
IYLNFIPKERLEGTVIKRRYKVLKRLGSGGMASVYLALDKKTNKEVAIKILHPQYASDKE
VLERFYREIETCKNLDHPYIVKVLDHGKEDDYVFMVMEFVNGKDLKKIIEEKKRIPINMA
VEIVKKVAEALSYANSKNIVHRDIKPQNIMITTDGKVKLMDFGIARVGGLATLTQTGMFM
GTPQYASPEQLEGKKVDIRSDIFSLGIVFYEMLTGILPYSDEDTISLMLKRYQEDLPDVR
AINPEVPEGIAKIIEKMTARFPEFRYQTPEELLEDLKRGYPLYPYDKKSITSSDTIIKRD
NKD
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaatattgataaagtttggattactttttggcttttttatattgcttcttatc
ctgtctaatcttaattttttcaaggtatgggagaagcaaacagtagatctcaggtttcat
ctaaggggagaaattaatccttataaggatatagtaattattggtatagatgacgactcc
attttagagctcggtaattggccttggagaagagatatccatgctaagcttattgatgta
ttgagaaaagagaagcctaagattattgtttttgatgttctttttgatacagctactcct
tttgatgcgattttggcagaaaagataaaatctgcaggtaatgtggttctttcaggatat
cttcagacttattttgataaaagattaaaaattaatgtagtttccttacgagaacctgtt
gagattttgaaaaactctgctcttggaagtggttatagtaacttgtatattgatgaagat
aacaaggtaagaagagttagaatctatgaaaattctggatctgtaaaatattattctctt
gcccttgtggcttacaaattcataagtaaaaaggatttttcctcccttactctaaccctt
ccttcggatttttatattaattttagaggaggagaaggaacttacagggtctattcttat
gtcaatgtattgagaggtaattttccaaagaatacttttagagacaagatagttttggtt
ggagctgtaagtcctgccttgaaagatctttttttacatcccttttctggattttcttca
aaacttggaataaattactcttacatgccaggtgtagaaattcatgctaacataattgat
aatttatttatgcgggacttttttactaatatatttccaccgtttgttttgataataaat
tttctttcaatatttctacctggagttttatttggaaggagaatcatattaaatttattc
ctaactttcttatttatctttttgtattttatgttctcatatcaagcttttataaatagg
gttttacttcctttagtttcaccctctgtaggatttgttttttcatttttaggaaattta
atttacttgaactttatacccaaagaaaggttggagggtacggttataaagagaagatac
aaagtacttaaaaggcttggatcagggggaatggcttctgtttatcttgctcttgataag
aagactaataaagaagttgctattaaaatacttcatcctcaatatgcttctgataaagaa
gtactggaaagattttatcgagaaatagaaacttgcaagaatcttgatcatccttatatt
gtgaaagttttagaccatggtaaggaagatgattatgtatttatggttatggagtttgta
aatggaaaggatcttaagaagattatagaggagaaaaagagaattcctattaatatggct
gttgagattgttaaaaaggtagccgaagctctttcttatgctaattctaaaaacatagta
catagagacataaagcctcaaaatattatgattactactgatggtaaagtaaagcttatg
gactttggaatagcaagggttggaggccttgccacattaactcagacaggaatgtttatg
ggtacacctcaatatgcttctccagagcaattggaaggtaaaaaagtagatataagatca
gatattttctctcttggtattgtcttctatgagatgttaacgggtattcttccatattca
gatgaggatacaatctctcttatgctgaagagatatcaagaagatcttcccgatgttaga
gctataaatcctgaggttccagaggggatagcaaagattattgaaaaaatgacagctaga
tttcctgagtttagatatcaaacaccagaagaactcttagaagatttgaagagaggatat
cctctctatccttatgataagaagagcataacatcttcagatacgataattaagagggat
aataaagattaa

DBGET integrated database retrieval system