KEGG   Dictyoglomus thermophilum: DICTH_1769Help
Entry
DICTH_1769        CDS       T00774                                 

Definition
phosphomannomutase/phosphoglucomutase (EC:5.4.2.2 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dth  Dictyoglomus thermophilum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICTH_1769
   00030 Pentose phosphate pathway
    DICTH_1769
   00051 Fructose and mannose metabolism
    DICTH_1769
   00052 Galactose metabolism
    DICTH_1769
   00500 Starch and sucrose metabolism
    DICTH_1769
   00520 Amino sugar and nucleotide sugar metabolism
    DICTH_1769
  Nucleotide metabolism
   00230 Purine metabolism
    DICTH_1769
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DICTH_1769
Enzymes [BR:dth01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     DICTH_1769
    5.4.2.8  phosphomannomutase
     DICTH_1769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1727812..1729236
Genome map
AA seq 474 aa AA seqDB search
MIILDKTIFRMYDIRGEVPKNLNKDVARIIGKAYAVFIRKRINKENLTISVGRDARISSK
ELSEGLIEGLRSSGINVIDIGLCPTPLLYFSLFTLPVDGGIMITGSHNPPQFNGMKICVG
KETIYGPLIQELYEIAVNIKDETSTKEGSYETYDIISAYKEFLIKEFQNSAITRLPQGTI
KLVIDSGNGCGGLVVPDVLRKLGVNVIDLFSEPDGNFPNHHPDPTVIETLKTLRETVIKE
KADFGVAYDGDADRIGVVDEKAEIVYGDRLAYIFAKGILKENPGAKIIGEVKCSKFLFEG
IEKLGGIPVLSPVGHSLIKKKLREENALFAGEMSGHIFFNDRFFGYDDAIYATMRLVELY
AIEKLQNPNFVFSDFLKEFPKVYASPEIRVHCSEEKKFEIIKNFFDKLKEKYPEIANRVQ
KVITIDGVRLEFDDGWALARASNTEPVIVLRFEANTEERLKEYQEIFENIIKEC
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgataatcttagataaaaccatattcagaatgtatgatatccgaggagaagttccaaag
aatctaaataaagatgtggcaagaataattggaaaggcttatgcagtatttataagaaaa
agaatcaataaagaaaaccttacaatctctgtaggaagagatgctagaatttcttcaaaa
gaactttccgaaggcctaattgaaggattaagaagctcagggataaacgtaattgacata
ggtttatgtcctactcctctactctacttctctctctttacccttcctgtggatggagga
ataatgatcactggaagccacaacccaccacaatttaatggcatgaaaatctgtgtgggt
aaagaaaccatatatggtcccttaattcaagagttatacgagattgcagtaaatattaaa
gatgaaacttcaacaaaagaaggaagttatgaaacttatgatatcatctcagcttacaaa
gaatttcttataaaagagttccaaaactctgctataacaagactccctcaaggtacaata
aagcttgtaatagattctggaaacggttgtggaggacttgtagttcccgatgttttgaga
aagcttggagttaatgtgatagatcttttctcagaacccgatggaaattttcccaatcac
catccagacccaacagtgattgagactctaaaaaccctaagagagacagtgataaaagaa
aaagcagattttggagttgcctatgacggagacgcagacagaattggagttgtggatgaa
aaagcagaaatcgtgtatggagatagacttgcctatatctttgccaagggaatattaaaa
gaaaaccctggagctaaaattataggagaagtaaaatgctcaaaattcctctttgaaggt
atagaaaaattaggaggaattcccgtactctcaccagtaggacactccctgataaaaaag
aaattaagagaagaaaatgccctttttgcaggagagatgagtggtcatatatttttcaat
gatagattctttggatatgatgatgctatctatgctaccatgaggcttgtagaactttat
gctatagaaaaactccaaaatcctaattttgtattttcagatttcctgaaagaatttcca
aaagtatatgcatctcctgagattagggtacattgtagcgaagaaaagaaatttgagatt
ataaaaaacttctttgataaactaaaggaaaaatatccagaaattgccaatagagttcaa
aaagtcataaccatagacggtgtaagattagagtttgatgatggatgggctcttgcaaga
gcaagcaatactgaacccgtaattgtattaagatttgaggcaaacaccgaggaaagatta
aaagaatatcaagagatctttgaaaacataataaaagaatgttag

DBGET integrated database retrieval system