KEGG   Dictyoglomus thermophilum: DICTH_1786Help
Entry
DICTH_1786        CDS       T00774                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
dth  Dictyoglomus thermophilum
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    DICTH_1786
  Lipid metabolism
   00600 Sphingolipid metabolism
    DICTH_1786
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    DICTH_1786
Enzymes [BR:dth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     DICTH_1786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1749898..1752312)
Genome map
AA seq 804 aa AA seqDB search
MLKINLDKDWEYLEGNLAFLSQVLLRDDWKKVDLPHDIAIEKPRSKDNPSGPDEGFTAGA
NIFYRKDLVIDKELLGKNLILEFEGIMGYSEIYLNGTLLKKHFYGYSSFLVDITKYVHEG
LNTLLVYINNVHKPSSRWYAGTGIYRHVWLRVGGEVFIKPWELHVKSDVIDEKKALLDIK
VGLKSGKRIGGKLQFRIFSKEDELIKEDEENFEIDEEEKVISKILEIYNYRLWDIEDPYL
YKLEVKVLVDGEESDVDSTYFGIRKIEIIPKVGFKLNGRVIKLKGGCIHHDNGILGSASY
DRAEERKVEILKQNGFNAIRTAHNPFSPSFLDACDRLGMLVMEEFFDVWTMGKRAYDYHL
FFEKYWEEDIENTIKRDFNHPSIVMWSIGNEITWGSGVDWERDEGYASIFEWSERLSKKV
KELDSSRFVTSAFCGIPFENIKVENVEENGIVILGVWQEGEEVREKWGKITEKYFKTLDI
AGYNYKIDRYRYDAEKYPNRIICGTETFPYTLYDNWKETLENSNVIGDFVWTAMDYLGEA
GIGRASLDENEARNFLGHFPWLISNCGDIDICGDKKPQSYYRDIVWGLRKDPYIVVLPPE
IYGRKIYLKMWGWEPVERNYNFKGYEGKPLRVYIYSDADEVELFLNGKSMGRKIAGDRVK
YKVFYDLNYEEGRLEVIAYKNGVEVGRDILETTGDPVGLRLIPDRNIISSYEDLSFIKIV
AIDELGREVTDAKNKVRVKVEGVGKLLALGNADPVSQESFVGNEISLYKGRALAIVKSLG
LSGEIKLKVWGEGLKEEEVIIKCE
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagataaatcttgataaagattgggaatatttagaagggaatttagctttcttg
agccaagttctccttagagatgattggaaaaaggtggatcttccccacgatatagctatt
gagaaacccagaagtaaagataatccttcgggacctgacgagggatttactgctggagct
aatatcttttacaggaaagatttagttattgataaagaacttttgggaaaaaatttaatc
ttagaatttgaaggcataatgggatactcagaaatttatttaaatggaactcttcttaaa
aagcatttttatggatattcaagctttttggtagatattacaaaatatgtccacgagggg
ttaaatactctgttagtgtatataaataatgtacataaaccaagctccagatggtatgca
ggcactggtatttataggcatgtttggttgagggtagggggagaggtatttattaaacct
tgggaacttcatgtgaagagtgatgtcattgatgagaagaaggctttattagatattaag
gttgggctaaaaagtgggaagagaattggaggtaaattgcaatttaggattttttcgaaa
gaagatgaattaataaaagaggatgaagaaaattttgaaatagacgaagaagaaaaggtc
atctcaaaaatattagagatttacaattataggttgtgggatattgaagatccgtatcta
tataagctggaggtaaaagttttagtagatggggaagagtccgatgttgattctacttac
tttggtataagaaagattgagattatacctaaggttggttttaagttgaatggtagggtt
attaaactcaaaggtggatgtatacatcacgataatggaattcttggtagtgcaagctat
gatagggctgaagagagaaaagttgaaatcttaaaacagaatggttttaatgccataagg
actgctcataatcccttttctccatcctttcttgatgcctgtgatagattgggtatgttg
gtaatggaagagttttttgatgtatggactatggggaaaagggcctatgattatcatcta
ttctttgaaaagtattgggaggaagatatagaaaatactataaagagggattttaatcat
ccctccatagttatgtggtctataggtaatgaaataacttggggatcaggcgtagactgg
gagagagatgagggatatgcaagcatttttgaatggagtgagaggctttctaagaaggtt
aaagaattagactcttcaaggtttgtaacttctgccttttgtggaattccttttgaaaat
ataaaggtggaaaatgtggaagagaacggtattgtaatattaggagtttggcaagaaggt
gaagaggtaagagagaaatggggaaagatcactgaaaagtattttaaaacccttgatatt
gcaggatataactacaaaatagatagatatagatatgacgccgagaaatatcccaatcgt
ataatttgtggaaccgaaacttttccttatactttgtatgataattggaaggaaacctta
gaaaactccaatgtaattggagattttgtttggactgcaatggattacttaggtgaggca
ggtattggtagagcatcgttggatgagaatgaggcaaggaattttttagggcattttcct
tggttaatttctaattgtggagatattgatatttgtggtgacaaaaagcctcaatcctat
tatagagatattgtatggggattaagaaaagatccttatattgtagttcttccccctgag
atttatgggagaaagatatacttgaagatgtggggatgggaacctgtagagagaaattat
aatttcaagggttatgaaggtaaacctttaagggtttacatatattctgatgctgatgaa
gtagagctatttttgaatggaaaaagtatgggcagaaagattgctggagatagggtgaaa
tacaaagtcttttatgatttaaattatgaagaaggcagacttgaggttatagcttataaa
aatggggtagaggtaggaagagatattttagagactacaggagatcctgtaggtttgaga
ttgattcctgatagaaatataatttcttcttatgaggatcttagctttataaaaattgtt
gcaatagatgagttgggaagagaggtaacagatgcaaagaataaggtaagggttaaagtg
gaaggagtaggtaaattattagctttgggtaatgcagatcctgtttctcaggaaagtttt
gtaggaaatgagataagtctttataagggaagagctcttgcaatagtaaaaagccttgga
ctttcgggggagataaaattaaaagtttggggagaagggttaaaggaagaggaagtaata
ataaagtgtgaatga

DBGET integrated database retrieval system