KEGG   Dictyoglomus thermophilum: DICTH_1885Help
Entry
DICTH_1885        CDS       T00774                                 

Definition
alpha-glucosidase (EC:3.2.1.20)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
dth  Dictyoglomus thermophilum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dth00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dth00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dth00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1835435..1836793)
Genome map
AA seq 452 aa AA seqDB search
MVKISIIGAGSVSFSMKLIQDLNYYKDLSGSTVVFMDINEERLDLVYTLADKYMKETGAN
LKLEKTTDRKKAIDGADFVINTVKVGGYHNMEKEREIAESLGYYRGFGDRVSDYYGGFAA
YEQLKFIRELAKDVEKFAPDAWYMQVSNPVFEGTNLALRETGLKVVGFCHGYLELFHLIR
VLGLDPKDVEEQVAGFNHSIFLTKFKYKGENAYPLIDKWIEEEAPKLWSSYEYMISPWEY
TQLSPASVEMYRLYGLFPIGDTPRAVSPWWFHTDLNEKKKWYPAGGPDSEIGWTMYLYGL
KMRLAQMERLARDPNVSIVKELPVEESMESIIPFVDAIVNNHRRRLVLNVPNQGAIPGIP
DDVIVEIPVYVDKNGIEREKIEKIPSRLMLYVLIPRWLRMERILQAFQEGDRISLLLMVM
DDPRTKSFEQGKNLVETMLSQPWNEEMNKHYK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggttaagattagtattataggtgcaggtagcgtgtccttctctatgaagcttatccaa
gatcttaattattacaaagatctctctggaagtactgtggtatttatggatataaatgag
gaaagattagatttggtttatactctcgcagataagtatatgaaagagactggagcaaat
ttaaaactggaaaaaactacagacagaaaaaaagcaattgatggagcagattttgtaatt
aatacagtaaaagttggtggatatcataacatggagaaggaaagagagattgcagaaagt
cttggatactacaggggttttggagatagggtaagtgattattatggtggatttgcagct
tatgagcagttgaagtttataagagagcttgcaaaggatgtggaaaagtttgcgcctgat
gcttggtatatgcaggtttcaaatccagtatttgaagggacaaacttagctttaagagag
acaggactaaaggttgtaggtttttgtcatggatacttagaattattccatcttataaga
gtacttggacttgatcccaaagatgtagaagagcaggtagcaggatttaatcattctatt
tttcttacaaaattcaaatataaaggagaaaatgcctatcccttgatagataaatggata
gaagaggaagcgccaaaactttggagttcctacgaatatatgatatctccttgggaatac
acccaactttcacctgcaagtgtggaaatgtataggttatatggactatttcccatagga
gatacaccaagggctgtttctccatggtggtttcataccgatttaaatgagaagaagaaa
tggtatcctgcaggaggtcctgattctgaaataggttggactatgtatctttacggttta
aaaatgaggcttgctcagatggagagactggcaagagatcctaatgtatccatagtaaag
gaacttcctgtagaagagagtatggagtctataattccttttgtggatgctatagtcaat
aaccataggagaagacttgtattgaatgtgccaaatcagggtgcaattccgggaattcct
gatgatgtgatagtggaaattccggtatatgtggacaagaatggaatagaaagggaaaag
atagaaaaaataccatcgagattaatgctatatgttcttatacccagatggttgaggatg
gaaaggatactacaagcttttcaagaaggggatagaattagtctcttgcttatggttatg
gacgatccaagaacaaagagctttgaacagggtaagaatttagtagaaactatgctttct
caaccttggaatgaagagatgaataaacactataaataa

DBGET integrated database retrieval system