KEGG   Dictyoglomus thermophilum: DICTH_1984Help
Entry
DICTH_1984        CDS       T00774                                 

Definition
(GenBank) ketoisovalerate oxidoreductase subunit VorD
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00010  Glycolysis / Gluconeogenesis
dth00020  Citrate cycle (TCA cycle)
dth00620  Pyruvate metabolism
dth00633  Nitrotoluene degradation
dth00640  Propanoate metabolism
dth00650  Butanoate metabolism
dth00680  Methane metabolism
dth01100  Metabolic pathways
dth01120  Microbial metabolism in diverse environments
dth01130  Biosynthesis of antibiotics
dth01200  Carbon metabolism
Module
dth_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICTH_1984
   00020 Citrate cycle (TCA cycle)
    DICTH_1984
   00620 Pyruvate metabolism
    DICTH_1984
   00640 Propanoate metabolism
    DICTH_1984
   00650 Butanoate metabolism
    DICTH_1984
  Energy metabolism
   00680 Methane metabolism
    DICTH_1984
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DICTH_1984
Enzymes [BR:dth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DICTH_1984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_10 Fer4_7 Fer4_6 Fer4_16 Fer4_9 Fer4_2 Fer4_15 Fer4_13 Fer4_4 Fer4_17 Fer4_8 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ACI20071
UniProt: B5YCD1
Position
1952362..1952640
Genome map
AA seq 92 aa AA seqDB search
MKLPGWKELVNIGPIVPAQTSKEYKTGDWRTFRPEIDYSKCTTCLFCWLFCPDSAVKFDG
QKVYIDYDYCKGCGVCAAECPVKAITMKEEEK
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaccaggatggaaagaattagtaaatataggtcctattgtacctgcacaaact
tctaaagagtataaaacgggtgattggagaaccttcagacctgaaattgattatagcaag
tgcactacatgtctgttttgctggctcttctgccccgattctgcagtaaaatttgacgga
caaaaagtctacattgattatgattactgcaaaggttgtggtgtttgtgcagctgaatgt
cctgtcaaagcaataactatgaaagaagaagaaaaataa

DBGET integrated database retrieval system