KEGG   Dictyoglomus thermophilum: DICTH_1986Help
Entry
DICTH_1986        CDS       T00774                                 

Definition
(GenBank) PorB subunit of pyruvate:flavodoxin oxidoreductase
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
dth  Dictyoglomus thermophilum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DICTH_1986
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICTH_1986
   00020 Citrate cycle (TCA cycle)
    DICTH_1986
   00620 Pyruvate metabolism
    DICTH_1986
   00640 Propanoate metabolism
    DICTH_1986
   00650 Butanoate metabolism
    DICTH_1986
  Energy metabolism
   00680 Methane metabolism
    DICTH_1986
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DICTH_1986
Enzymes [BR:dth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DICTH_1986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1953856..1954791
Genome map
AA seq 311 aa AA seqDB search
MAINLREIALKEEKLVSGHRLCAGCGASIIVRMVLNAIDEPVVVANATGCLEVATTIFPF
NAWNVPWIHSAFENAAATIAGVEAAYKALKRKGEIDREIRFISFAGDGGTYDIGLQALSG
AIERGHRAVFICYNNEAYMNTGIQRSGATPRGAFTTTSPAGKAIPGKPQKRKNLTEMMVA
NGAKYVAQASPSHWRDLMEKVKKAVNTDGPAFLNIYSTCPRGWRTPDNSAISIARLAVET
GVWPLYEVENGKYKINYKPPKGFKPVEEFLKVQGRFAHLLKPENAHILEEFKKDIEEEWK
RLLSMEEATNK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaatttaagggaaatagccttaaaagaggaaaaattagttagtggacataga
ttgtgtgcaggttgtggagcaagcatcatcgtaagaatggtccttaacgctatagacgaa
cccgtagtagtagctaatgccaccggatgccttgaagttgccacaaccatattccccttt
aatgcatggaatgtaccatggatacattctgcctttgagaatgcagcagcaactatagca
ggagtagaggcagcatacaaagccttaaagagaaaaggagaaatagatagggaaataagg
tttataagcttcgccggagatggtggaacatacgacattggacttcaggctctctctgga
gcaatagagagaggacatagagcagtatttatctgctacaataacgaagcatatatgaac
acaggaatccaaagatcaggagcaaccccaagaggtgctttcactactacatctcctgca
ggaaaagcaattcctggaaaacctcagaaaagaaagaacttaacagaaatgatggtggca
aatggagcaaaatatgtggctcaagcatcaccaagtcactggagagatttaatggagaag
gtaaaaaaggcggtaaacaccgatggacccgcctttttaaatatatactccacatgtcca
agaggatggagaactcccgataattctgccataagtattgcaagacttgcagtagaaacc
ggtgtatggcctctctacgaagtagagaatggaaaatacaagataaattacaaaccgcca
aaaggatttaaacctgtcgaggagttcttaaaagtacaaggaagatttgcacacctcctc
aaaccagaaaatgctcatatattagaagaattcaaaaaagatatagaagaagaatggaaa
agactcctcagtatggaagaagctacaaataaataa

DBGET integrated database retrieval system