KEGG   Dictyoglomus thermophilum: DICTH_1986Help
Entry
DICTH_1986        CDS       T00774                                 

Definition
PorB subunit of pyruvate:flavodoxin oxidoreductase
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
dth  Dictyoglomus thermophilum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DICTH_1986
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICTH_1986
   00020 Citrate cycle (TCA cycle)
    DICTH_1986
   00620 Pyruvate metabolism
    DICTH_1986
   00640 Propanoate metabolism
    DICTH_1986
   00650 Butanoate metabolism
    DICTH_1986
  Energy metabolism
   00680 Methane metabolism
    DICTH_1986
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DICTH_1986
Enzymes [BR:dth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DICTH_1986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1953856..1954791
Genome map
AA seq 311 aa AA seqDB search
MAINLREIALKEEKLVSGHRLCAGCGASIIVRMVLNAIDEPVVVANATGCLEVATTIFPF
NAWNVPWIHSAFENAAATIAGVEAAYKALKRKGEIDREIRFISFAGDGGTYDIGLQALSG
AIERGHRAVFICYNNEAYMNTGIQRSGATPRGAFTTTSPAGKAIPGKPQKRKNLTEMMVA
NGAKYVAQASPSHWRDLMEKVKKAVNTDGPAFLNIYSTCPRGWRTPDNSAISIARLAVET
GVWPLYEVENGKYKINYKPPKGFKPVEEFLKVQGRFAHLLKPENAHILEEFKKDIEEEWK
RLLSMEEATNK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaatttaagggaaatagccttaaaagaggaaaaattagttagtggacataga
ttgtgtgcaggttgtggagcaagcatcatcgtaagaatggtccttaacgctatagacgaa
cccgtagtagtagctaatgccaccggatgccttgaagttgccacaaccatattccccttt
aatgcatggaatgtaccatggatacattctgcctttgagaatgcagcagcaactatagca
ggagtagaggcagcatacaaagccttaaagagaaaaggagaaatagatagggaaataagg
tttataagcttcgccggagatggtggaacatacgacattggacttcaggctctctctgga
gcaatagagagaggacatagagcagtatttatctgctacaataacgaagcatatatgaac
acaggaatccaaagatcaggagcaaccccaagaggtgctttcactactacatctcctgca
ggaaaagcaattcctggaaaacctcagaaaagaaagaacttaacagaaatgatggtggca
aatggagcaaaatatgtggctcaagcatcaccaagtcactggagagatttaatggagaag
gtaaaaaaggcggtaaacaccgatggacccgcctttttaaatatatactccacatgtcca
agaggatggagaactcccgataattctgccataagtattgcaagacttgcagtagaaacc
ggtgtatggcctctctacgaagtagagaatggaaaatacaagataaattacaaaccgcca
aaaggatttaaacctgtcgaggagttcttaaaagtacaaggaagatttgcacacctcctc
aaaccagaaaatgctcatatattagaagaattcaaaaaagatatagaagaagaatggaaa
agactcctcagtatggaagaagctacaaataaataa

DBGET integrated database retrieval system