KEGG   Desulfomonile tiedjei: Desti_0017Help
Entry
Desti_0017        CDS       T02147                                 

Definition
Mg-chelatase subunit ChlI (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
dti  Desulfomonile tiedjei
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dti00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(16893..18857)
Genome map
AA seq 654 aa AA seqDB search
MSSFNHQYPFSAIFGQDSMKLALLLTIINPLIGGVLIRGEKGTAKSTAVRALVRFLPAVR
TNNHSSIFSTDKFQPPAHIDHENGGPRARVVTLPLHATEDMVLGGLDFSKSLQAGKPEFQ
PGLLARAHGGILYVDEVNLLSDHLVNTILDVTASGENLVQREGIFYRHPAKFVLVGTMNP
EEGELRPQLLDRFGLCVEIKAETKIAARIEVLRRKDEFERQPQLFCKRFEQEDSLLLKRL
SRAAHILPHVRLTRRIGSFIVEICTVHHVAGHRADVVIAHTARALASFEERTEIVDQDVE
RAAALALPHRSRLAAFENKKKKSGHSPQSSVVNPLLWEEYPDSSPRHLVPPTENFEEEIH
GTTERRALRTDSPEAIFDIGQSFKVREIVHSPEKRVRQTTGRRSRTTAANKRGKYIRAAE
PRGNHDLALDATLRAAAPHQIHREKKPGMAVVIRNEDIREKIRETRTGNFLLFLVDASGS
MGAKGRMVASKGAIMSLLHDAYQKRDRIAMISFRKQEAVVNLPPTSSMYLAGKLLKELPV
GGKTPLAAGLRKGGELLRTMMIKDPGCRPIVIVITDGKANEGIGKGDPFWEALAIAQSIA
SDKRIKSVVVDAEEEGTFHDGLAARLAKVMAADYFRIKDLKADVLLRIARNSGT
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgagcttcaatcatcagtatcctttttctgctatcttcggacaggattccatgaag
ctcgcgttgctcctcaccattatcaacccgctcataggaggcgtgttgattcgaggtgaa
aagggtacagccaaatccactgcagtccgagctttagtccgttttcttcccgctgtccgc
accaacaatcattcttcgattttctcgaccgacaaatttcagccgcctgctcatatcgac
catgaaaacggcggccctcgagctcgtgttgttactctgcctctccatgcaacggaagac
atggtccttggcggattggatttttcaaaatcgctccaggccgggaaaccggagttccag
ccgggtctcctggctcgtgcgcatggcggtatattgtatgtagatgaagtgaatttgctt
tcagatcatcttgtcaacacaatccttgacgtgaccgcttcgggagagaacctggtccaa
cgggagggtatattttatcgtcatcctgcaaagtttgtgcttgtcggaaccatgaatccg
gaagaaggagagctcagacctcaattgctcgaccgcttcggattgtgcgtggaaatcaaa
gcagagaccaagatcgcagctcgaatcgaggtgcttcgtcgcaaagacgagtttgaacgg
caaccccaattattttgtaaaagattcgaacaggaagactcattactcttaaagcggctc
tcccgcgctgcgcacattctgccgcatgtccgtttgacccgacgaatcggatctttcatt
gtcgagatttgcacggttcaccatgtcgccggacacagagctgatgtggtgatagctcat
acggctcgagcacttgcttcgttcgaagagcgaaccgagattgtggaccaagatgtcgaa
agagctgctgcattggctcttccgcatcgttccagactggcagcctttgaaaacaagaag
aaaaaatcgggtcactctccgcaatcttctgttgtcaatccccttttatgggaagagtat
ccagactccagccctcgtcaccttgtaccgcccacggagaatttcgaggaggagatacac
gggaccacagaaagacgtgcactgcgaaccgacagccctgaggcaatcttcgacatcgga
cagagcttcaaggttcgagaaatagtgcattcgcctgaaaaacgtgtgcgccaaacaaca
ggcagacgatcccgcacaacagccgcgaacaagcgaggcaaatatattcgggctgcggaa
cctcgcggcaatcatgatctggctctggatgcaacgttgagagccgcggctccacatcag
attcatcgggaaaaaaagcccggaatggcggttgtcatcagaaacgaagatatcagagaa
aaaatccgggaaacacgaactggcaattttctcctttttcttgtggatgccagtggctcc
atgggggcaaaagggagaatggtcgcttctaaaggtgcaatcatgtcattgttgcatgac
gcatatcagaagcgagatcggattgcgatgatatcgttcaggaaacaagaggcggtggta
aatcttcctcctacttcttccatgtacttggctggtaagctgttgaaagaactcccggtt
ggcggaaaaacacctctcgccgcgggtctgcgcaaaggcggcgaactcttgcgcactatg
atgatcaaagatccaggttgcagaccgattgtaattgtgattacggatggaaaagctaac
gaaggtatcggcaaaggcgaccctttctgggaggctcttgccattgcacagagcattgcc
tctgataaacggatcaaatcagtggtggtggacgcagaggaagaaggaactttccatgat
ggattggccgcgcgactggcaaaagtaatggctgcagattactttcgcatcaaggatctc
aaggcggacgtacttttgagaatcgctcgaaacagcggtacctga

DBGET integrated database retrieval system