KEGG   Desulfomonile tiedjei: Desti_0041Help
Entry
Desti_0041        CDS       T02147                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dti  Desulfomonile tiedjei
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dti00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Desti_0041
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Desti_0041
Enzymes [BR:dti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Desti_0041
Two-component system [BR:dti02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Desti_0041
Bacterial motility proteins [BR:dti02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Desti_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
49824..50897
Genome map
AA seq 357 aa AA seqDB search
MIKVLVVEDSPVALELLKHILSSDPEITVVGTATNGLEAVEFVQRERPDVVTMDIIMPKM
DGFEATRQIMGTCPVPIVIVSASLVREEVEKTWRAVEAGAVAVLEKPRYVGLGRTTEEGE
RLVQTVKLMSQVKVVRRWNKASSAVPAPKTSLPSPRPIAKPDRQIVPVSEQKIKLVAIGA
STGGPPVLQQIFSSLPLSFPAPILLVQHISPGFTHGFVDWLNRTATLQARLADDGERIIP
GNIYVAPDGHQMKVDAGGRIILTTEEAENGIRPSISYLFRSVAHAFGAKSMGILLTGMGR
DGADELKTMRDKGALTIAQDKESSIVYGMPMEAVRLGAAQYSLPPDKIIDMLMKISS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagtcttggtggttgaagactcaccggtggcgttggaactgctgaagcatatt
ctttcgtccgatcccgagataaccgtagtcggcacagcgacgaacggtctcgaagccgtt
gaattcgtgcagcgcgagcggcccgacgtggttacgatggacatcatcatgcccaaaatg
gacggttttgaagccactcgtcagatcatgggaacttgtcccgttcccatagtcatagtc
agtgcaagcctggtgcgtgaagaagtggagaaaacctggcgcgcagtagaagcgggtgct
gtggcagtcctcgaaaaaccccggtacgtcggtttggggcgaaccacggaagaaggggag
cgactcgtccaaacagtaaagctcatgtcccaggtcaaagtggtcaggagatggaacaag
gcttcttctgctgtgccggcacccaagacgagcctgccgtcccctcgtccgattgcgaaa
cccgatcgacaaatcgtccctgtttccgaacaaaaaattaaactggtggcgataggagct
tctaccggcggtccacccgtgctgcaacagatcttctccagtttaccgctgtcctttcca
gctcccatactcctggttcagcacatatccccgggattcacccacggatttgtagattgg
cttaaccgaactgccacgctgcaggctcgccttgcggatgacggcgagcgaattatcccg
ggcaacatatatgtggcacctgacggtcaccagatgaaggtcgatgccggaggtcggatt
atcctcaccacggaagaagctgaaaacggtatccgcccttcaatttcgtatctattccgc
tctgtggcgcatgctttcggtgctaaatccatgggtatcctgctcacaggaatggggaga
gacggggcggacgagttgaagaccatgcgcgacaaaggagcgcttacaatcgctcaagac
aaggaaagtagtattgtttacggtatgccgatggaagcggtgagactgggggcagcccag
tattcgctcccaccggacaagattattgacatgttgatgaagatctcctcgtag

DBGET integrated database retrieval system