KEGG   Desulfomonile tiedjei: Desti_0218Help
Entry
Desti_0218        CDS       T02147                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00010  Glycolysis / Gluconeogenesis
dti00071  Fatty acid degradation
dti00350  Tyrosine metabolism
dti00625  Chloroalkane and chloroalkene degradation
dti00626  Naphthalene degradation
dti01100  Metabolic pathways
dti01110  Biosynthesis of secondary metabolites
dti01120  Microbial metabolism in diverse environments
dti01130  Biosynthesis of antibiotics
dti01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desti_0218
  Lipid metabolism
   00071 Fatty acid degradation
    Desti_0218
  Amino acid metabolism
   00350 Tyrosine metabolism
    Desti_0218
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Desti_0218
   00626 Naphthalene degradation
    Desti_0218
Enzymes [BR:dti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Desti_0218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AFM22964
UniProt: I4C073
Position
complement(266553..267551)
Genome map
AA seq 332 aa AA seqDB search
MKAMILEKTGPIEASPLRLSEIPIPEPGQGEIRIKVSACGVCHTDLHTVEGDLEIRKLPV
IPGHQIVGTVDKTGPESEIHQIGDRVGVTWFFSGCGACSFCLEGRENLCSSAQFTGYHAN
GGYAEYMTVPEGSAFPIPSVFSDADAAPLLCGGVIGYRALRLSEIQPGGNLGLYGFGNSA
HVVIQVAVKLGCRVHVFTRGEKHRQLARELGAVWVGAPDELSPTLLQASIIFAPAGPLVP
VALRTLEKGGTLVLAGITMTPIPEMDYSLIYWERTVKSVANTTRSDARELLRIAAEIPIR
TVVQEFSLERANEVLLMMKNSELKAGAILTPA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaatgattctggaaaaaacggggcccatagaagcctcgcctctcagattgtct
gaaataccaattcctgaaccaggtcagggagagatacgcatcaaagtctctgcgtgcggt
gtctgtcacacggatcttcatacagtagaaggtgacctggaaatccggaaactccctgtg
atcccgggacatcaaatcgtgggcacagtcgacaaaaccgggccggaatccgaaatacac
cagatcggagaccgcgtcggcgtaacgtggtttttctccggttgcggagcatgctccttc
tgtctcgagggccgggaaaacctctgtagttcggcacaatttaccggataccatgctaac
ggcgggtacgcagagtacatgacagtgccggagggatctgcatttcccattccgtcggta
ttctcagatgcagatgccgcgccactgctgtgcggcggagtgatcggttatcgcgcacta
agactgagtgagatccaacccggaggcaatctcggcctgtacgggttcgggaattccgcc
catgtggtgattcaggtggccgtcaagttgggctgtcgcgtgcacgtgttcactcgcgga
gaaaaacatcggcaactggctcgagaattgggagcagtatgggtcggagctccggatgag
ttgtctccaaccttgctgcaagcctcgattatttttgctcccgcgggtcctcttgtcccc
gttgcgctacgaacattggaaaagggtggcaccctcgttcttgcgggaatcaccatgact
ccaattcccgaaatggattacagcctcatctattgggaacgtactgtcaaaagcgtggcg
aacaccactcgaagcgacgcacgagaactccttcggattgcagcggagatccctatccgc
acggtggtccaggaattctccttggaaagggcaaacgaagtgcttcttatgatgaagaac
agcgaattgaaagccggtgcgatcctgactccagcttga

DBGET integrated database retrieval system