KEGG   Desulfomonile tiedjei: Desti_0802Help
Entry
Desti_0802        CDS       T02147                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dti  Desulfomonile tiedjei
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Desti_0802
Enzymes [BR:dti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Desti_0802
Exosome [BR:dti04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desti_0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
919492..920469
Genome map
AA seq 325 aa AA seqDB search
MHYPLYRPRRLRKSEEFRRMIRETRLSVDDLVSPLFVVPGKNVKKPISSMPGNFQMSTDF
IVEEVRKIKGLGIPAVLLFGIPDSKDESASGAFAKDGIIQTAVAEIKNAVPDIIVITDVC
LCEYTSHGHCGMIRGTEVDNDPSIDILAETGLSHAVAGADMVAPSAMMDGQVFAIRKALD
QNGYAGTPIMAYSAKYASCFYGPFREAAESAPQFGDRKTYQMDPPNSNEAMREIALDIEE
GADIIMVKPALPYLDVIQRAKDMFDLPVAAYNVSGEFSMIKAAAKLGWIDGDRAMMEAVT
AIKRAGADIIITYFAPEIARFLQDQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcactaccctctttatagaccgagaagattgaggaaaagtgaagaatttagaaggatg
atcagagaaacgaggctgtcagtagacgatctcgtttctcctctctttgttgtgcctggc
aagaatgtcaagaagccaatttcgtccatgccgggcaatttccagatgtccaccgacttc
atagtggaagaagtgcgaaagataaaaggtttgggcatcccggccgtcttacttttcgga
atacctgacagcaaagacgaatctgcttcgggagcttttgccaaggacggaatcatccaa
acagcagtagcagagatcaagaatgcggttcctgatatcatcgtcattaccgatgtgtgt
ctctgcgaatacaccagccatggtcactgtggtatgatccgaggcacggaagtcgacaac
gacccgagtatcgacatcctcgccgaaaccggtttgtcccatgccgttgccggagctgac
atggtggctccttccgctatgatggacggacaggtgttcgcaataagaaaagcccttgac
caaaatggttatgcgggcacccccatcatggcctactcagccaagtatgcgtcatgtttc
tacggtccattcagagaagccgctgaaagcgctccacaattcggcgatagaaaaacatac
cagatggacccgcccaacagcaacgaagccatgagagaaattgccctggacattgaagag
ggtgcagacattatcatggtgaaaccggctcttccatatctcgacgtcattcaaagagct
aaagacatgtttgatttgccggttgcagcttataacgtcagtggcgagttttccatgatt
aaggcggcagccaaactaggatggattgacggagatcgagccatgatggaagcggtaacc
gcgattaagagggcaggagcagatatcatcattacctattttgcaccggagatagccagg
tttcttcaagaccagtag

DBGET integrated database retrieval system