KEGG   Desulfomonile tiedjei: Desti_1139Help
Entry
Desti_1139        CDS       T02147                                 

Definition
protein-L-isoaspartate and D-aspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dti  Desulfomonile tiedjei
Brite
Enzymes [BR:dti01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Desti_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1358613..1359380)
Genome map
AA seq 255 aa AA seqDB search
MYNCPQNRQHVFCFTRVAALLAFLIVCSIDILVSAQSLPVSEMQQERKRMVETQFKGLGR
TPIENAAVLQAMLTVPRHLFVPSSHRRLSYEDTPLPIGFGQTISQPYIVALMTQALGVEP
GMKVLEIGTGSGYQAAVLAQITPHVYTVEIIEELYRSASKRLQDLGYSSVVVRQGDGYFG
LSEGAPYDRIIVTCAALHIPAPLFDQLKPGGKMIIPVGGGFETQRLLLVSKDQQGGRTSQ
TLELVRFVPLLRGTH
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtataactgtccgcaaaatcgacaacatgttttttgctttacccgggttgccgcacta
ttggcattcctgatcgtctgctcgattgacatccttgtatccgcacaatctctacccgtt
tccgaaatgcagcaggaacgcaagcgcatggtggagactcagttcaagggtctcggccgc
actcccatagaaaacgctgcagtgctgcaagctatgctcacggttcctcgtcatctgttc
gtgccgagcagtcacaggcggttgtcatatgaagacactcctttgcccataggattcggt
cagaccatttcccagccgtacatcgttgctctcatgactcaggcgctgggagtggaaccg
ggaatgaaggttctcgaaatcggtaccggctccggatatcaggctgcagttctggcacag
attacgcctcacgtgtacacggtggaaattatcgaagagctgtaccggtcggcatccaag
cgacttcaggatctgggctattcatccgtcgtcgttcgccagggggatggatacttcggc
ctgagcgagggtgctccctatgatcgcatcattgtaacctgtgcagcattgcacatacct
gcccccctgttcgatcagctcaagcccggaggcaaaatgattatcccggtggggggcggt
ttcgaaacgcaaagactcctgctcgtgtcaaaagaccagcagggtggccgtacttcacag
actctggaactcgtacgattcgttcccctgctccgtggaacacattga

DBGET integrated database retrieval system