KEGG   Desulfomonile tiedjei: Desti_1210Help
Entry
Desti_1210        CDS       T02147                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dti  Desulfomonile tiedjei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desti_1210
   01230 Biosynthesis of amino acids
    Desti_1210
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desti_1210
   00030 Pentose phosphate pathway
    Desti_1210
   00051 Fructose and mannose metabolism
    Desti_1210
   00052 Galactose metabolism
    Desti_1210
  Energy metabolism
   00680 Methane metabolism
    Desti_1210
Enzymes [BR:dti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desti_1210
Protein phosphatases and associated proteins [BR:dti01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Desti_1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1442685..1443965)
Genome map
AA seq 426 aa AA seqDB search
MDTAIESLGVARIPSPLKHVQHVTDDECILYDSSARNVEQQIREGQTPVSFMKAGPRDFM
YFDPSKLKCAVVTAGGLCPGLNNVIRAIVLTLYYSYGVRNVLGIRYGFQGLVPQYGHPIL
ELTPKSVGDIAELGGTVLGSSRGPQSVEDMVDALERMNVGILFAIGGDGTMRAVSKICEG
IRNRNAKISVIGIPKTIDNDISYMSRSFGFNTAVTVAAEVITAAHVEATGSPNGIGLVKL
MGRRAGFIASYAALAKRDANFVLIPESDFDLEGPHGFLAVLEKRILDRKHAVIVVAEGAG
QQYAHGEGTDESGNPRLGDIGIFLKEAIDEYFKGKGIELNLKYIDPSYTIRSVEATSDDA
IFCTFLAQNAVHAGMAGKTNMVVGNWRDEYVYIPVDLVITGRKQVELDGKLWSSVLEATG
QPSFKP
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggataccgcaatagaaagcctgggagttgctcggatcccctcaccattaaagcatgtt
cagcatgtaacggatgatgaatgcattctctacgattcctctgcaagaaacgtggagcag
caaattcgagaaggccaaacgccagtctctttcatgaaggccggtcccagagactttatg
tatttcgacccgagcaagctcaaatgcgcagtagtaacggccggtggcttgtgtcccggc
ctgaataacgttatccgggctatcgtcctgacactgtattactcgtacggcgtacgaaat
gtcctgggaatacgatatggtttccaggggcttgttcctcagtacggacatcccatactg
gagcttaccccgaagtctgtgggagacattgcggaactcggtggaacagtgctcggatcg
tctcgaggacctcaaagcgtcgaagacatggtggatgcactggaacggatgaatgtcggc
attctcttcgccattggcggagacggcaccatgcgggctgtctccaaaatctgcgaaggg
ataagaaatcgcaatgcaaagatatccgtcataggaatccccaagacgatagataacgat
atcagttacatgtctcgctccttcggtttcaacactgctgtgacagtagctgctgaagtg
attaccgccgcacacgttgaagctaccggttctccaaatggtatcggactggtaaaactc
atgggacggcgcgcggggttcattgcctcatacgccgctttggccaagcgggacgcgaat
tttgttctcatcccggaatccgatttcgacctggaggggccccacggattcctggctgtc
ctggaaaaacgaattctcgaccgcaagcatgccgttatagtcgtagccgaaggtgcagga
cagcagtatgctcacggtgaaggcacggatgaatcaggaaatccgcgcctgggcgatatc
ggaattttcctaaaagaagcgatagacgaatatttcaaaggaaaaggcatcgaactgaac
cttaaatacatcgatccgagctatacgattcgttccgtagaagccacttcggatgacgcc
atcttctgcacgtttctggctcaaaacgcggtgcacgcaggaatggccggtaaaaccaac
atggtagtaggtaactggcgcgacgagtatgtttacattcctgtggatcttgtgataaca
ggacgtaaacaggtggagctggatgggaaactctggagcagtgtcttggaggctacaggt
caaccatcctttaaaccataa

DBGET integrated database retrieval system