KEGG   Desulfomonile tiedjei: Desti_1264Help
Entry
Desti_1264        CDS       T02147                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dti  Desulfomonile tiedjei
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Desti_1264
   00052 Galactose metabolism
    Desti_1264
   00500 Starch and sucrose metabolism
    Desti_1264
   00520 Amino sugar and nucleotide sugar metabolism
    Desti_1264
Enzymes [BR:dti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Desti_1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1500454..1501839)
Genome map
AA seq 461 aa AA seqDB search
MKRDIPVELIRKKMRGRAIELDIEEHFLRMVRQVVEEKSDYVPLDGLCAPTSEFVLDPTG
DDIQELTKAGKELLRHVAVIKLNGGRATTMGGRVPKGILKAKDGLTYLEIILAQMDACFW
KWGVDLPLIFMNSFFTDAATARIIAGKRNPPRTFIQNQVPRLVEDSLAPLDTGTDEDWAP
PGHGDIYLSLKRSGILQDLIRSGFRWAFISNLDNLAACVDPWIPALMENQGIEFLLEVTD
RTESDRKGGTLVLQNNRLDLLEIAQVNPAERDLFMDIRRFQVFNTNNVWVDLPALDRILN
EGDLKLPLIRNRKNIAGRPVIQLETAMGSAIGSFPGARGLRVGRDRFFPTKKTSDLFVLQ
SDACILDTMARIRKNPSRAECLPLRPNVFFSSNFVDSPDHLLSRFEDSSSISLVNAHSLE
VFGSAFFGRDITINGRVEIKVPDGTVFHIPKGTSLAEGKYP
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcgacattccagtagagcttatcagaaagaaaatgaggggtcgcgcaattgaa
ctcgacatcgaggaacacttcttgcgcatggttcgtcaggttgtggaggaaaaatcggac
tacgtacctctcgatggactctgtgcaccgacctccgagtttgttctggatccgaccgga
gacgacattcaagaattgacaaaagcgggaaaagagcttctaaggcacgtcgcggtcata
aaattgaacggaggccgcgccaccacgatgggtggcagggttccgaaagggatcctcaaa
gccaaagacggattgacgtatcttgaaatcatcctcgctcagatggatgcgtgtttctgg
aaatggggggtagatcttccactcatcttcatgaatagtttcttcaccgatgccgccact
gccagaattatcgcggggaaaaggaaccctccgagaacgtttatccaaaatcaggtacct
cggttggtggaggattcccttgctccactggataccggcacggacgaagactgggctcct
ccgggacatggagacatttatctgagcctcaaacggtctggtatcctccaggatctgatc
agaagcggatttcgatgggcgttcatatccaacctggacaatttggctgcatgcgtggat
ccgtggatacccgcgctcatggagaatcaaggaattgagttcctcctggaagtgaccgat
cggaccgaatcggatcgcaagggtggaacactcgtattgcagaataatcgactcgatctc
ctggaaatcgctcaggtgaaccccgcggagcgcgatctgttcatggacatacgacgattc
caagtattcaacacgaacaatgtatgggtagatcttcccgcgctggatcgaatactgaac
gaaggcgacctgaaattaccgctcatccgcaataggaaaaacattgcagggaggccggtg
attcaactcgaaacggcaatgggatcggcaatcgggtcattcccgggtgctcgtggctta
agggtcggccgagatcgtttttttccgacaaagaaaaccagcgatctgttcgttctccaa
tcggatgcatgcatcctggacaccatggctcgcattcggaaaaatccttccagggccgaa
tgtttgccgcttaggccaaacgtctttttctcgtcgaatttcgtggactctccggaccac
ttgctcagtcggttcgaagattcctcctctatctcactggtgaatgcgcattctcttgag
gtgttcggttccgcttttttcggaagggacattaccatcaacggcagggtggaaattaaa
gtccctgacggaaccgtttttcatattcccaaggggacctcgttggctgaaggaaaatac
ccatag

DBGET integrated database retrieval system