KEGG   Desulfomonile tiedjei: Desti_1266Help
Entry
Desti_1266        CDS       T02147                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dti  Desulfomonile tiedjei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desti_1266
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desti_1266
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desti_1266
Enzymes [BR:dti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desti_1266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1502325..1503707)
Genome map
AA seq 460 aa AA seqDB search
MPIKFFLHEDEIPRQWYNIAADMPTPMQPPLHPGTGQPVGPQDLAPVFPMNLIEQEVSQE
RWIDIPDEVLDKLLLWRPTPLYRAEKLEKFLNCPVKIYYKNEGVSPAGSHKPNTAIPQVY
YNKVFGIKRIATETGAGQWGSALSFACNQFGLEAKVYMVRVSYEQKPYRRLMMNTWGGTC
IPSPSTETEAGRKILAMDPNSPGSLGIAISEAVEDAVTSEAMGRPPTRYSLGSVLNHVML
HQTIIGLEAQKQLAMAGDYPDIVIGCAGGGSNFAGCAFPFIRDKIAGKKIDIIAVEPASC
PTMTKGVFTYDFGDTVQMTPLLPMHTLGHSFVPEPIHAGGLRYHGMAPLVSQLVLDGLIE
PRAVRQLETFAAGVTWARTEGFISAPETCHALAAVFQEAQKAKEEGREKTILVNWSGHGL
VDLAAYDAYFQGKLFDYELPQEAIQEALKALDGFPKPALG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaattttttctccacgaagacgagattcccaggcagtggtacaatattgct
gcagacatgccgactcctatgcagccccctcttcatccgggaacaggtcagcctgtaggt
ccgcaggatctggcgccggtttttccgatgaatctcatcgaacaggaagtcagtcaggaa
agatggatagatattcccgatgaagttctggataagctgctgctctggcgtcccactccg
ttgtatcgtgcagaaaaactcgagaaatttctaaactgtccggtcaagatttactataaa
aatgaaggcgttagtcccgcaggaagtcacaaaccgaatacggcaattcctcaggtttat
tacaacaaagtcttcggtatcaagagaattgcgactgaaaccggagcaggtcagtgggga
agcgctctcagtttcgcatgcaatcagttcgggttggaagcgaaagtatatatggtgcgg
gtgagctacgagcaaaagccctatcgtaggctcatgatgaacacatggggcggaacctgc
ataccttctcccagcacggaaaccgaagcgggccggaaaattctggcaatggaccccaac
tctccgggcagtctcggcatagccattagcgaagcagtggaagatgctgtcacgagcgaa
gcaatggggcggcctccaacgcgctactctctcggaagcgtgttgaatcatgtcatgctg
caccagaccatcatagggctggaagctcaaaagcagcttgcgatggctggagactaccct
gatatcgtaattggttgtgcgggtggaggcagcaattttgccggatgcgcgttcccgttt
atccgtgacaagattgcgggaaagaaaatcgacattatagccgtggaacccgcttcgtgc
ccgaccatgacaaagggagtcttcacctacgatttcggggatactgttcagatgactcct
ctccttcccatgcacacactggggcactcattcgttcccgaacccattcatgccggtgga
ttgcgctatcacggcatggccccgctcgtcagccaactggtactggacggccttatcgag
ccgcgtgcagtgagacaactggaaacctttgcggcaggagtaacgtgggccaggactgag
ggattcatcagcgctcctgaaacatgtcacgcactggcagcggttttccaggaagcacaa
aaagccaaagaagaaggtagagaaaagaccattctggtgaactggagtggccacggcctc
gtagaccttgcggcttacgatgcttacttccagggcaaactgttcgattacgagttgcct
caggaagcgatccaggaagcactcaaggcacttgacggattccccaaacctgctctcggg
tag

DBGET integrated database retrieval system