KEGG   Desulfomonile tiedjei: Desti_1341Help
Entry
Desti_1341        CDS       T02147                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00010  Glycolysis / Gluconeogenesis
dti00020  Citrate cycle (TCA cycle)
dti00620  Pyruvate metabolism
dti01100  Metabolic pathways
dti01110  Biosynthesis of secondary metabolites
dti01120  Microbial metabolism in diverse environments
dti01130  Biosynthesis of antibiotics
dti01200  Carbon metabolism
Module
dti_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desti_1341
   00020 Citrate cycle (TCA cycle)
    Desti_1341
   00620 Pyruvate metabolism
    Desti_1341
Enzymes [BR:dti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Desti_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: AFM24054
UniProt: I4C3B3
Position
complement(1590352..1591674)
Genome map
AA seq 440 aa AA seqDB search
MRYVFKLPDVGEGIAEAEIVEYLVKVGDQVSADQPVVRIETDKAVVELPCPVKGVIAEIP
FNPGDSVEVGQTILVIETEEAAKQERAESPEPQEAPPAEKKPAPPAETPPPSPLMKERPE
GEPTPPPPAARVQATPHTRKLARELKVDINTVQGTGPHGRITDEDVRRAAEGERAAPPPK
PVPAAVPKREEVMPEPAAAGADFDKYGPIRREPLRGVRKRIAEVMVKSVSTIPHVTHFDE
ADVTELMAVVEREKPLAESRGFKLTVLAFVIKAAAAGLKQFPMLNCSLDDQTGDIIYKDY
YNIGFATDTESGLMVPVIRDVDRKSVLQIAGELQELSKKARARSIELDDMRGGTFTVTNV
GALGGSWATPIIVHPQVAILCPLRAQPKAVVQDGQVAIRTIMPLTLSFDHRVLDGADAAR
FLNFVIGLLNDPMRMLVDMA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgagatacgtattcaaactgccggatgtaggggaaggcattgctgaagccgaaatagtc
gaatacctggtcaaggtcggagaccaggtgtccgcagatcagccggtagtgaggattgaa
accgataaagccgttgtggaacttccttgtcccgtgaagggagtcatagcggaaatccct
tttaatccgggagattcggttgaagtcggtcagacgattctggtcattgaaaccgaagaa
gctgctaaacaggaacgggcggaatcgcctgaaccgcaagaggcaccacctgccgagaag
aaacccgcacctcccgccgaaactcctcctcccagtcccttgatgaaagaacggcctgag
ggagagccgacgcccccaccccctgcggcacgggtgcaggcgaccccgcatacgaggaag
cttgcccgggaactcaaggttgatatcaacacagtacaaggaaccgggcctcacggccgt
atcactgacgaagacgtacgaagagcagcggaaggcgaaagagctgctccaccacctaaa
cccgtacctgcagcagtcccgaaacgggaagaagtcatgcctgagcctgcagccgcgggt
gcggacttcgacaaatacggaccgatcaggagagaacccctccgtggtgtaagaaaacgt
attgcggaagtcatggtgaaatccgtatccacaataccgcacgtaacccatttcgatgaa
gccgatgtcacagaacttatggcagttgtcgaacgcgaaaagccgttggccgagagcaga
ggattcaagctcacggtgcttgcctttgtaatcaaggctgcagcagcgggattaaagcag
tttccgatgctcaattgttcgcttgacgatcagaccggcgacatcatttacaaggattac
tataacatcgggttcgcgactgacacagaatccggtctcatggttcccgtgatccgggat
gtggatcggaaatccgtgctccagattgccggcgagttgcaagaactgagcaagaaagcc
agggccagatccatagagcttgacgacatgcgaggcggaacctttaccgtgaccaatgtg
ggagctttaggaggttcgtgggctaccccaataatagtgcatccgcaggtcgcaatactc
tgtcccctgagggcgcaacccaaagcagtagtgcaggacggccaggtggcaatccgaacc
atcatgcctttgactctgtcattcgatcatcgggtattggatggggcggatgccgcacga
tttctcaattttgtcataggtctcttgaacgatcccatgcgtatgctggtcgatatggca
tga

DBGET integrated database retrieval system