KEGG   Desulfomonile tiedjei: Desti_1687Help
Entry
Desti_1687        CDS       T02147                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dti  Desulfomonile tiedjei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dti00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2008977..2010464
Genome map
AA seq 495 aa AA seqDB search
MLTRGSGILIHITSLPSRFGIGDLGPWAYKFVDFLAESRQSFWQILPLTVTNPGHHSPYN
SPSAFACNPLLISPEFLVRDGYVSNDDLGTPNFRNDQVDYSAVEQYKIGLLWKAFWTFKK
KTDYEYELFIEKNRIWLDDFALFMAYKKRVDNRGWNEWPYEIRDRHPEALKAIARDLSQY
VEMEKFVQFIFHKQWTALSEYCKEKSIQLIGDIPIYVDFDSADVWCHPQYFKLDENKKPY
AVGGVPPDYFSETGQLWGVPIYQWGTLEHDGFKWWIQRLERNLSLCQFLRIDHFRGLVGY
WEVPAHEQTAINGRWIEGPAERFFKAVLKKFPKIPLVAEDLGIITPDVREVMRTFELPGM
KVLLFSFGDDQPTNPYTVHNFEKNYIAYTGTHDTNTIRGWFDHEASPEQKQRVWEYLGRN
EAPDELHWDMIRLIMMSVAAVSMFPMQDVLGLGNESRMNFPSVKEGNWRWRLLPEQLTPE
LTKKLARLSVLYGRA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgctaactcgaggaagtggtatactcattcatataacatctctgccgtcccgcttcgga
ataggcgatcttgggccatgggcgtataaattcgtagacttcttggctgaaagtagacag
agtttctggcagatactacctctgacagtcaccaacccgggccaccattctccctataac
agcccgtccgcattcgcgtgcaatccgctcctgatcagtccggaatttctcgtgagagac
ggatatgtatcgaacgacgatttgggaacaccgaattttcggaacgatcaggtggactat
tccgctgtcgagcaatacaaaattggcttgctctggaaggccttttggacattcaagaaa
aagaccgattatgaatatgagctctttatcgagaagaaccggatatggcttgatgatttt
gccttattcatggcttacaaaaagcgggtcgacaacaggggctggaacgaatggccgtac
gaaatccgcgatcgtcatcctgaagcgctcaaagccatcgcgagagacctgagccaatat
gtggaaatggaaaagttcgttcagttcatattccacaagcaatggaccgcgctttccgaa
tactgtaaagagaaaagcatccagttgatcggcgacattccgatctatgtcgatttcgac
agtgctgatgtctggtgccatccgcaatatttcaagctggatgagaacaagaaaccgtac
gcggtgggaggcgttcctcccgattacttcagcgagaccggtcaactctggggagttccc
atatatcaatggggtactctcgagcatgacggcttcaaatggtggattcaacgtctcgag
cgcaacctgagcctttgccagtttctcaggatcgatcatttcagaggattagtgggatac
tgggaggtgccggcccacgaacaaacggcaatcaacggcaggtggatcgaggggcctgcc
gaacgattcttcaaggcagtgctcaagaaattccccaaaattccacttgttgcagaggac
cttggtattattactccagacgttcgcgaggtgatgcggacattcgaattacccggtatg
aaagtgctgctgttttcctttggcgacgaccagcccacaaatccatacacagtacacaat
ttcgagaaaaactacattgcgtacaccgggactcacgataccaatacgattcgggggtgg
ttcgaccatgaagcttctcccgagcaaaagcagcgagtctgggagtatctgggacggaac
gaggcacccgacgagttgcactgggatatgatacgactgataatgatgtctgttgctgcg
gtgtccatgtttcccatgcaggatgtgctcgggttggggaacgaatcccggatgaatttt
ccttcggtcaaagagggcaattggcgctggaggctccttccggagcagctaacccctgag
cttacgaaaaagcttgctcgcctgtcggtactctatgggagagcatga

DBGET integrated database retrieval system