KEGG   Desulfomonile tiedjei: Desti_1694Help
Entry
Desti_1694        CDS       T02147                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dti  Desulfomonile tiedjei
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desti_1694
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desti_1694
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desti_1694
Enzymes [BR:dti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desti_1694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2019586..2020638
Genome map
AA seq 350 aa AA seqDB search
MWKGIIRQYPDFYRFASDSHVITLLEGNTPLIPVPRLAAKIKPGISLYLKYEGLNPSSSF
KDRGMTLAVSRAVEAGSNSVICASTGNTSASAAAYAARAGIKAFVLIPEGKIALGKLAQA
MIHGAIVIKILGNFDEALKLVREISDNYPVTLVNSVNPHRIEGQKSAAFEVCDALGVAPD
YHCLPVGNAGNITAYWAGYKVYKDAGKINALPKMFGFQAEGAAPIVRGHIVENPETVATA
IRIGNPASWKPAEAARDESGGLIDMVTDEEILEAYKMVASLEGVFCEPASAASIAGLIKK
SREGYFETGSTIVCTLTGHGLKDPDNAIKVSTDPVTCEPDMKKVLNVLGF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaggcatcataagacaatatccggacttctatcgattcgcatccgatagtcac
gtgataacgcttctggaagggaatactccgcttattccggttccacgattggcagccaaa
attaaaccggggatctcgctgtacttgaagtacgagggactcaatcccagttcctcgttc
aaggaccggggcatgactctggctgtttccagagcagtggaggctgggtcgaattccgtt
atctgcgcgtctaccggcaatacgtctgcttcggctgcggcatacgcggcaagagccgga
atcaaggctttcgtgctcattccggaaggcaaaatagctctgggaaagcttgctcaggct
atgattcacggtgccatcgtcattaaaatcctcggaaatttcgacgaggcattgaaattg
gtacgtgaaatatctgataattatccggtaaccttggtgaactcggtgaatcctcacagg
atcgaaggtcaaaaatccgcggcattcgaggtctgtgacgctcttggcgttgcacctgat
tatcactgtctgcccgttggcaatgcaggaaatatcaccgcgtactgggcaggttacaag
gtatacaaggatgcgggaaagataaacgcattgccgaaaatgttcggattccaggcagaa
ggagcagctcccattgtgagaggtcatattgtggaaaatcctgagactgtggcaactgcc
atcagaatcggaaacccggcttcgtggaaaccggcggaagccgcccgagacgaatccgga
ggtctcatcgatatggtaactgatgaggagattctggaagcgtacaagatggttgcatcg
cttgaaggagtcttctgtgagcccgcctctgccgcttctatagccggtctgatcaaaaag
agccgcgaaggctacttcgagacaggatcgacaattgtatgtactctcacgggacatgga
ctcaaagatcccgataatgccataaaggtgtcaaccgatccggtcacttgcgagccggat
atgaagaaggtgctgaatgtcctcggattctaa

DBGET integrated database retrieval system