KEGG   Desulfomonile tiedjei: Desti_1912Help
Entry
Desti_1912        CDS       T02147                                 

Definition
aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dti  Desulfomonile tiedjei
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dti01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dti00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2297865..2299865
Genome map
AA seq 666 aa AA seqDB search
MRYAETGFNLEIDLTRGNVERVESDPRDTELYLGGLGTNAKILWDRVPPEVDPFSPDNLL
IFSAGLLCGTPATGCNRTIVSTVSPQTQLMSFSMMGGFFAPELKYAGYDKVILRGKSPKL
VYIWINNDKVEIRDAAHLKGKGTVETAELIRQELKEPNAQVASIGLAGENRVYFASIEQG
RSSASRGGIGAVMGDKGVKAIVVRGTKDVNVAQPAEFMDLCKEVLNYIKFRNDNPIPGVM
PILAGLGSPQEMKVHDEKWHTENFMWGNSRVRRKDFWNDEIAKQWAETLDSMRTRLISCY
NCPMTCGATISPPGLPTYMMKCFSKLTYTMAAFSDLEFGLGIAQSATEYGVDGFSTPQVM
AFALELYENGILTDDDFPGMPADNEGRFYWLLDRIVRREGIGDILANGTYWAAKQIGKGA
EAYAHNNIKKHEQLPLKLSMLNPIYFLMYCTGEKINITQIEGQFPQAPFLTMEEREAFVK
DWFQVPDEKFKQYFLDWEPRGEKSMPFYPTVEMCCDIVDWQERMHYIDDALGMCAGLSSF
PLKPPYHIHNYPKFISAGAGIDMDEEKLTQATKRYRTLIRAYNVRRGMRRKDDKPPENHW
KKRFPELEKQLLDTYYQFKGWNRQGIPTKESLHELDLDYVAEEFEKRGIYSEDDTTPGES
LAQATA
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgaggtacgcagaaacagggttcaatttagagatcgatctaacccggggaaacgttgaa
agggtagaaagcgatccgagagataccgagctttatttggggggcctcggcaccaacgcg
aaaatactatgggacagggtgcctcctgaagtcgaccccttttcacccgataatcttctc
atattcagcgcaggtctcttatgtggcacgcctgctaccggctgcaatcgcaccattgtt
tccaccgtctcgccccagactcagttgatgtctttttccatgatgggaggttttttcgca
cccgaactgaagtatgccggttatgacaaagtgatcctacgcggcaagtcccccaagctg
gtctacatatggatcaataatgacaaagtggaaatacgcgatgccgcccatttgaaggga
aaaggcactgtcgaaacagccgagcttatccgacaggaattgaaggaaccaaatgcccag
gtagcttccatcggactggcaggcgaaaacagagtctattttgcttccatcgaacagggc
aggtccagcgccagtcgaggcggtatcggcgcagtaatgggagacaaaggtgtaaaagcc
atcgttgttcgtggaacgaaggacgtcaatgtcgcccaaccggctgagttcatggacctc
tgcaaagaagtgctgaattacataaaattccgaaatgacaatccgattccaggtgttatg
cccattctggccgggctcggatcgccccaggaaatgaaagtccacgatgaaaagtggcat
accgaaaattttatgtggggaaattcacgtgtccgcagaaaagacttctggaacgatgaa
atcgcaaagcagtgggctgagaccctggacagtatgcggacgcgattgatcagttgctat
aactgtccgatgacatgcggagcaactatttctcctcccggacttcccacgtacatgatg
aagtgtttctcgaagctcacttataccatggcggccttttcggacctggaattcggtctg
ggtattgctcaaagcgccacggagtacggagttgacggattctcgactccgcaagtcatg
gcctttgcccttgagctttacgagaacggcatactgactgacgatgatttcccgggaatg
ccggcagataatgaagggagattctactggttactcgatagaattgtccggcgcgaaggg
attggagacatcttggccaatggtacatattgggcggccaagcagatcggtaaaggcgct
gaggcctacgctcataacaatataaaaaaacatgagcaacttcctctcaagctatcgatg
ctgaatcccatttatttcctcatgtactgtaccggcgagaagatcaacatcactcagatt
gaagggcaattccctcaggctcccttcctcacgatggaggagagagaagcgttcgtgaag
gattggttccaggttcccgatgagaaattcaaacagtatttcctggactgggaaccacgc
ggagaaaaatcgatgcctttctatccgaccgttgaaatgtgttgtgacattgtcgactgg
caggaaagaatgcactacatcgatgatgctctgggaatgtgcgccggtttgtcttctttt
ccgctgaagcctccatatcacatccacaattatcctaaattcatatccgcaggtgcaggg
attgatatggatgaagagaagctgacacaagcaaccaagagatataggactttgatccgg
gcctacaatgtcagaaggggcatgagaaggaaagacgacaagccccctgagaaccactgg
aagaagagatttcccgaactcgaaaagcaacttctggacacgtattaccagttcaaaggg
tggaaccgccaaggcattcccaccaaggaatctctgcatgagttggatttggattacgta
gccgaagagttcgagaagaggggtatctattcagaagatgatacgacacccggtgagagt
ctggcgcaagcgactgcataa

DBGET integrated database retrieval system