KEGG   Desulfomonile tiedjei: Desti_1912Help
Entry
Desti_1912        CDS       T02147                                 

Definition
(GenBank) aldehyde:ferredoxin oxidoreductase
  KO
K19515  
benzoyl-CoA reductase subunit BamB [EC:1.3.-.-]
Organism
dti  Desulfomonile tiedjei
Pathway
Benzoate degradation
Metabolic pathways
Microbial metabolism in diverse environments
Module
Benzoyl-CoA degradation, benzoyl-CoA => 3-hydroxypimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Desti_1912
Enzymes [BR:dti01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.-  Acting on the CH-CH group of donors
    1.3.-.-  
     Desti_1912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2297865..2299865
Genome map
AA seq 666 aa AA seqDB search
MRYAETGFNLEIDLTRGNVERVESDPRDTELYLGGLGTNAKILWDRVPPEVDPFSPDNLL
IFSAGLLCGTPATGCNRTIVSTVSPQTQLMSFSMMGGFFAPELKYAGYDKVILRGKSPKL
VYIWINNDKVEIRDAAHLKGKGTVETAELIRQELKEPNAQVASIGLAGENRVYFASIEQG
RSSASRGGIGAVMGDKGVKAIVVRGTKDVNVAQPAEFMDLCKEVLNYIKFRNDNPIPGVM
PILAGLGSPQEMKVHDEKWHTENFMWGNSRVRRKDFWNDEIAKQWAETLDSMRTRLISCY
NCPMTCGATISPPGLPTYMMKCFSKLTYTMAAFSDLEFGLGIAQSATEYGVDGFSTPQVM
AFALELYENGILTDDDFPGMPADNEGRFYWLLDRIVRREGIGDILANGTYWAAKQIGKGA
EAYAHNNIKKHEQLPLKLSMLNPIYFLMYCTGEKINITQIEGQFPQAPFLTMEEREAFVK
DWFQVPDEKFKQYFLDWEPRGEKSMPFYPTVEMCCDIVDWQERMHYIDDALGMCAGLSSF
PLKPPYHIHNYPKFISAGAGIDMDEEKLTQATKRYRTLIRAYNVRRGMRRKDDKPPENHW
KKRFPELEKQLLDTYYQFKGWNRQGIPTKESLHELDLDYVAEEFEKRGIYSEDDTTPGES
LAQATA
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgaggtacgcagaaacagggttcaatttagagatcgatctaacccggggaaacgttgaa
agggtagaaagcgatccgagagataccgagctttatttggggggcctcggcaccaacgcg
aaaatactatgggacagggtgcctcctgaagtcgaccccttttcacccgataatcttctc
atattcagcgcaggtctcttatgtggcacgcctgctaccggctgcaatcgcaccattgtt
tccaccgtctcgccccagactcagttgatgtctttttccatgatgggaggttttttcgca
cccgaactgaagtatgccggttatgacaaagtgatcctacgcggcaagtcccccaagctg
gtctacatatggatcaataatgacaaagtggaaatacgcgatgccgcccatttgaaggga
aaaggcactgtcgaaacagccgagcttatccgacaggaattgaaggaaccaaatgcccag
gtagcttccatcggactggcaggcgaaaacagagtctattttgcttccatcgaacagggc
aggtccagcgccagtcgaggcggtatcggcgcagtaatgggagacaaaggtgtaaaagcc
atcgttgttcgtggaacgaaggacgtcaatgtcgcccaaccggctgagttcatggacctc
tgcaaagaagtgctgaattacataaaattccgaaatgacaatccgattccaggtgttatg
cccattctggccgggctcggatcgccccaggaaatgaaagtccacgatgaaaagtggcat
accgaaaattttatgtggggaaattcacgtgtccgcagaaaagacttctggaacgatgaa
atcgcaaagcagtgggctgagaccctggacagtatgcggacgcgattgatcagttgctat
aactgtccgatgacatgcggagcaactatttctcctcccggacttcccacgtacatgatg
aagtgtttctcgaagctcacttataccatggcggccttttcggacctggaattcggtctg
ggtattgctcaaagcgccacggagtacggagttgacggattctcgactccgcaagtcatg
gcctttgcccttgagctttacgagaacggcatactgactgacgatgatttcccgggaatg
ccggcagataatgaagggagattctactggttactcgatagaattgtccggcgcgaaggg
attggagacatcttggccaatggtacatattgggcggccaagcagatcggtaaaggcgct
gaggcctacgctcataacaatataaaaaaacatgagcaacttcctctcaagctatcgatg
ctgaatcccatttatttcctcatgtactgtaccggcgagaagatcaacatcactcagatt
gaagggcaattccctcaggctcccttcctcacgatggaggagagagaagcgttcgtgaag
gattggttccaggttcccgatgagaaattcaaacagtatttcctggactgggaaccacgc
ggagaaaaatcgatgcctttctatccgaccgttgaaatgtgttgtgacattgtcgactgg
caggaaagaatgcactacatcgatgatgctctgggaatgtgcgccggtttgtcttctttt
ccgctgaagcctccatatcacatccacaattatcctaaattcatatccgcaggtgcaggg
attgatatggatgaagagaagctgacacaagcaaccaagagatataggactttgatccgg
gcctacaatgtcagaaggggcatgagaaggaaagacgacaagccccctgagaaccactgg
aagaagagatttcccgaactcgaaaagcaacttctggacacgtattaccagttcaaaggg
tggaaccgccaaggcattcccaccaaggaatctctgcatgagttggatttggattacgta
gccgaagagttcgagaagaggggtatctattcagaagatgatacgacacccggtgagagt
ctggcgcaagcgactgcataa

DBGET integrated database retrieval system