KEGG   Desulfomonile tiedjei: Desti_2017Help
Entry
Desti_2017        CDS       T02147                                 

Definition
(GenBank) methylase of chemotaxis methyl-accepting protein
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
dti  Desulfomonile tiedjei
Pathway
dti02020  Two-component system
dti02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dti00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Desti_2017
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Desti_2017
Enzymes [BR:dti01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Desti_2017
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Desti_2017
Two-component system [BR:dti02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Desti_2017
Bacterial motility proteins [BR:dti02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Desti_2017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest CheR PAS_10 PAS_4 CheR_N PAS_9 PAS HOOK IncA Fez1 CENP-F_leu_zip Spc7 FPP OmpH DUF3584 Rootletin Atg14 Not3 Exonuc_VII_L GAS HMMR_N HAUS-augmin3 V_ATPase_I TPR_MLP1_2 ATG16 APG6 CALCOCO1 Seryl_tRNA_N Mnd1 DUF4407 Methyltransf_12 ADIP DUF1664 ZapB TMPIT LMBR1 Golgin_A5 IFT57 Laminin_II HIP1_clath_bdg
Motif
Other DBs
NCBI-ProteinID: AFM24720
UniProt: I4C579
Position
complement(2420741..2423725)
Genome map
AA seq 994 aa AA seqDB search
MAKKKSADGKEGQKHKLQGTSEGIKPANQKVLIESQSRQRDRQTLRVVGIGASAGGLEAF
EHFFTNLPPDTGLSFVLVQHLDPTHKSILTDLIKKYTRMEVREVTDGTVIEANYVYVIPP
NKDMAILNGTLYLMDPSSPRGLRQPIDFFFRSLAEDLKEQAIAIVLSGTGSEGTLGIRAI
KGEGGMVMVQDPGTARYDGMPRSAVATGLVDYVVSPDKMPHHLLAYVRHAPGAIPTADVE
PTGEDGNIVQKILILVRARTHHDFTHYKKNTIIRRIERRMAVHQLLKKQDYLRFLQDDPL
EVKTLFKELLIGVTNFFREPDAFEALQKKALPKILNGDSQYMRIWVPACSTGEEAYSIAM
LVQEYAAEAKIDFHLQIFATDIDEEAIEKARLGVYPLSIAADVNPKRLERFFIKEENQFR
IKKELREMIVFAFQNVISDPPFSKLDLISCRNLLIYMNTELQKRLIHLFHYALKSDGFLF
LGASESVGSYSTLFTMADRKWKLYQRKDTATMAALQPNLQFRESSELPEIKTELRLTKAT
FRDIAEKALLEAYHAAGVVTDEKLDAIYFYGSTARYLSPASGEASFNLLKMAREELRFEL
ANAVRRAQTENKTVVRPGLRLKSKQGSEAVNLIVRPVLAPSNRHLLLILFEEATYAKGTK
ESEDVPLPQDESDVQARNRELEHELASAKEYLQTTIEELETSNEELKSTNEELQSANEEL
QSTNEELETSKEEQQSVNEELATVNSELQQKIEELSKVNDDMNNLLASTQVGTIFLDTDM
NVLRFTPAVTELINLIQSDIGRPLAHIVSNLNYDRIVEDSRRVLESLIPRTREVQTKDGR
WFVMRMQPYRTTENVIEGVVLTFVEITFQKQQMAENVLCESIMNMAREIFLVLDERLTVT
SANGQFYEAFAVRKEDTIGRRLYDLGNRQWDIPDLRQLLEKIIPEHKEVKGFEVEHEFES
IGRRKMSLDAKQIDADGDKPRLILLVIQDITDRP
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaagaaaagcgcagatgggaaagagggtcagaagcacaaattgcaggggact
tcagagggaatcaaacctgcaaaccagaaggtccttattgaatcacaatcgagacaaaga
gacaggcaaacgctccgagttgtcggtatcggtgcgtcagccggtggcctggaagctttc
gaacatttcttcaccaatctccctcccgatacaggcttgtcatttgtgcttgtccaacat
cttgaccccacccataagagcattctcaccgacctgatcaagaagtatacccggatggag
gtcagggaagtcacagatggcacggtgatcgaagccaactatgtctacgtcatcccgccg
aacaaagacatggccatcttgaacggcacgctttacctcatggacccctcttccccgaga
ggtttgcgtcagcccatagacttcttcttccgatccttggcggaagacctcaaagagcaa
gccatcgccattgtgctgtccggaaccggaagcgagggaaccctgggcatacgagccatc
aagggtgaaggcggcatggtcatggtacaggaccccggaacggccaggtacgatggaatg
cccagaagcgcagtcgccaccggactggttgactatgtcgtatcgcctgacaaaatgccg
caccatttgctggcatatgtgcggcatgcccccggtgccatacctacggcagacgtcgag
ccgacgggtgaagacggcaacattgtccagaagatcctgatcctggttcgggcaaggact
catcacgatttcacccattacaagaaaaacacgatcatccgccgcatcgagagacgtatg
gccgttcaccagctcctcaagaagcaggattacttgcgttttcttcaagacgatccgtta
gaggtgaagacgcttttcaaagaactcctcatcggagtgacgaacttctttcgtgagccg
gatgcattcgaggcattacagaagaaagcccttcccaaaatactgaacggggacagccag
tacatgcgaatatgggtgcctgcgtgttcaaccggcgaggaagcgtattccattgcaatg
cttgtgcaagaatatgcggcagaagcaaagatcgactttcacctgcagatatttgccacg
gacatagacgaagaagccatagaaaaagctcgccttggagtctatccgttgagcatcgca
gcagatgtcaaccccaaacggctcgaacgattctttatcaaggaagagaaccaattccgt
atcaagaaagagcttcgggaaatgatcgtgttcgctttccagaacgtcatttcagacccg
cctttttcgaaattggacctcattagctgcagaaatctcctcatctacatgaataccgaa
ttgcagaaacggttgattcacctctttcattatgccctaaaatccgacggattccttttt
ctgggtgcctcggagtcagtcgggtcttattcgacattgtttaccatggcggatcgcaaa
tggaaactgtaccagcgaaaggacacggccaccatggcggccctgcagccaaatcttcag
ttccgcgagtcttcggaattgcccgagatcaaaactgaattgagattgacgaaagccact
ttccgagacattgcagaaaaggcgttgctagaggcctaccatgcagcaggtgttgtgact
gacgagaaacttgatgccatttatttctacggttccacagcgcgatatttgtcgccggcc
tcaggagaagcgagtttcaaccttctcaaaatggcccgtgaagaactgaggttcgaactc
gccaatgctgtacggagagctcagaccgagaacaagacagtggtacgccccggcttgcga
ctgaaaagtaaacagggctctgaggcagtcaacctcattgttcgacccgtgctcgctccg
tccaacagacacctgcttctcatactattcgaggaagcaacgtatgcgaagggaacaaag
gaatcggaagatgtgcccctgccccaggatgagagcgacgtccaggcaagaaaccgcgag
ctcgagcatgaattggcgtccgctaaggagtatctgcagaccaccattgaagaactggaa
acctcaaacgaagagttgaaatcaacgaatgaggaattgcagtcggccaatgaagagctc
cagagtacgaatgaggaactggaaacttccaaggaagaacagcagtccgtgaatgaagaa
ctggctacggtcaattcagaattacagcaaaagatagaggaactgtccaaggtcaatgat
gatatgaataacctgctcgccagcacgcaggtcggaacgatatttcttgacacagatatg
aacgtcttgcgtttcacccctgcagtcacggagttgatcaacctgattcaaagcgatata
ggtaggccgttggctcatattgtctcaaaccttaattacgacaggattgtcgaggactct
cggcgtgttctcgaaagcttgattccacgcacgagagaagttcagacgaaagacggtcgc
tggttcgtgatgcgtatgcagccctacagaacgacggaaaacgtcattgaaggggtagtt
ctgacgtttgtggagataaccttccaaaagcagcagatggcggagaacgtgctctgtgag
agtatcatgaacatggcacgtgagattttcttggtcttggacgagagattgaccgtgacc
tcggcgaatggccaattctacgaggcgtttgctgtgcgcaaggaagacaccattggaaga
cggctctacgatctggggaatcggcagtgggatattcccgacttgcggcagcttctcgaa
aaaatcattccggaacataaggaagtcaagggattcgaagtggagcatgagttcgaatcc
atagggaggcggaaaatgtccttggatgcaaagcagattgatgccgacggagacaaacca
agacttattctcctagtcatccaagacatcaccgaccggccctga

DBGET integrated database retrieval system