KEGG   Desulfomonile tiedjei: Desti_2345Help
Entry
Desti_2345        CDS       T02147                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00010  Glycolysis / Gluconeogenesis
dti00620  Pyruvate metabolism
dti00640  Propanoate metabolism
dti00680  Methane metabolism
dti01100  Metabolic pathways
dti01110  Biosynthesis of secondary metabolites
dti01120  Microbial metabolism in diverse environments
dti01130  Biosynthesis of antibiotics
dti01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desti_2345
   00620 Pyruvate metabolism
    Desti_2345
   00640 Propanoate metabolism
    Desti_2345
  Energy metabolism
   00680 Methane metabolism
    Desti_2345
Enzymes [BR:dti01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Desti_2345
Lipid biosynthesis proteins [BR:dti01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Desti_2345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFM25032
UniProt: I4C641
Position
2789021..2790985
Genome map
AA seq 654 aa AA seqDB search
MENTPKWYDAHLQDYRKVAYIKSKEEYDELYNRSINDIDRFWSEQADKYLTFEKRWDSVL
KYDFNTADIEWFGGGILNASYNCLDKHVDKLKNKVAYYWEGDNPAESKVVTYLELYNEVN
KFAAVLLANGVKKGDRVIIYLPMIVELPVAMLACARIGAVHGVIFGGFSAESIASRIQDC
GAKIVVTVDGGFRAGKPLPLKKNVDEALTRCPEVTKVIVFKHAGMDLKLDPSKEIWWHEA
MADPNLPSYVKPEPMSSEDPLFILYTSGSTGKPKGVLHTHAGYLLHAAMTNRLVFDLKDD
ETFWCTADIGWITGHSYTVYGPLINGFTSVLFEGVPNYPGWDRYWEIVAKRKVDKFYTAP
TVIRSLAREGAGWVEKHDLSSLKLLGTVGEPINPEAWRWYYHYVGRDWCPIVDTWWQTET
GGQMITPLPAVAPIKPGSCSFPFFGIDPVILDPDTGEEVKYPGQEGALFIRKPWPGMART
VFGDHQRFIDTYFSRIPGMYFTGDGAKQDEDGYFWIAGRIDDVINVSGHRLGTAEVESAL
VLHPDVAEAAVVGFPHPIKGQGIYAFVTLNQGVAKTDELRKGLVNLVRQQIGPIATPDAI
QWADALPKTRSGKIMRRLLRKISAGQIDDLGDTTTIADPSVVDTLVKGRVVLNA
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggagaatactccaaaatggtacgacgctcatcttcaagactatcgcaaggtcgcttac
atcaagagcaaagaggaatacgacgagctctataaccgatctattaatgatatcgaccgc
ttctggagcgagcaagccgacaaatatctcacctttgagaaaagatgggattccgttctg
aagtatgatttcaataccgccgacatcgaatggttcggaggcggcattctcaacgcctct
tacaattgcctggataagcatgttgataaactaaagaataaagtcgcctactattgggaa
ggcgacaatcccgcagaatcaaaagtggttacctatctggaactctataatgaagtcaac
aagtttgctgccgtgctcctggccaacggtgtgaaaaaaggtgaccgtgtaattatttac
ctccccatgatcgtcgaacttccggtggcgatgctggcgtgcgcccgcattggagccgtg
cacggcgtgatcttcggaggattcagcgccgagtccatcgcgagccgtatccaagactgc
ggtgcaaaaattgtcgtcacggtggacggcggcttcagggcaggtaaacctctgccgctc
aagaagaatgtggacgaggcgctcaccagatgtcccgaagtcacgaaagtgatcgttttc
aagcatgccggcatggacctgaaactcgatcccagcaaagagatctggtggcacgaagca
atggcggacccgaatctgccttcgtacgtcaagccggagccaatgtcatcggaagatccc
ttgttcattctgtacaccagtggcagcaccggaaaacccaaaggggtactgcacacccat
gccggatacctgcttcacgctgccatgacgaatcggcttgtgttcgatttgaaggatgat
gagacattctggtgcactgcagacatcggatggatcaccggccatagctacactgtgtac
ggacctttgatcaatggcttcacaagcgtgcttttcgaaggagtgcccaattacccggga
tgggacaggtactgggaaatcgtggcaaaacgtaaggtagacaaattctacaccgcaccg
acagtaatcaggtctcttgcgcgagaaggtgccggctgggtagagaaacacgacctgagt
tccctcaaactgcttgggaccgtgggagagcccatcaaccccgaggcctggagatggtat
tatcactacgtgggacgcgattggtgccccatagtcgacacttggtggcagacagagacc
ggcggccagatgattactccgttgcctgcagtcgcacccataaaaccgggttcgtgcagt
tttccgttcttcgggatcgatccggtgattttggaccctgatacaggtgaagaagtcaag
taccccggacaggaaggagcgctcttcattcgtaagccgtggccgggaatggccagaacc
gttttcggcgatcatcagaggttcatcgatacctatttcagccgtattccgggaatgtac
tttaccggtgacggagcgaaacaggacgaagatggttatttctggatagccggtcgtata
gacgacgttatcaacgtgtccggtcaccggctgggcacggcggaagtcgagtccgccctt
gttcttcatccggatgtcgcggaagctgcagttgtcggttttccgcatcccatcaaaggc
cagggcatttacgctttcgtgaccttaaaccagggggtagccaagactgacgaactgagg
aaaggtctggtgaacctcgtgcgtcaacagatcgggcctatcgcaactccggatgccatc
cagtgggctgatgctttgcccaaaacgcgcagcggcaagatcatgcgaaggctgctgagg
aagataagtgccggccagatagacgatctgggcgacaccacaacaattgccgatccctcc
gtggtggatacactcgtcaagggacgcgtagttctcaacgcttaa

DBGET integrated database retrieval system