KEGG   Desulfomonile tiedjei: Desti_2348Help
Entry
Desti_2348        CDS       T02147                                 

Definition
acyl-CoA synthetase/AMP-acid ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dti  Desulfomonile tiedjei
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desti_2348
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desti_2348
   00620 Pyruvate metabolism
    Desti_2348
   00640 Propanoate metabolism
    Desti_2348
  Energy metabolism
   00680 Methane metabolism
    Desti_2348
Enzymes [BR:dti01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Desti_2348
Lipid biosynthesis proteins [BR:dti01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Desti_2348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2792660..2794381
Genome map
AA seq 573 aa AA seqDB search
MIETGIPPDKEEANLETYAEKGTSFSWAELEREFTWYESGELNIVQEALDRWARLRDEKS
RKALIFEKAGKTLVFTYQELRESSCQWANLLTEYGLTVGDRVFIFLPPCPEIYFLMLACA
RLGIIFSPLFPDLSFDELAFRLQNARPRSIVTHPDLIERLPDHALSSVERIFLTEGAGVG
LFPNELPIKDIIGTLPRKSAIKWVRGTTPLYLLYTSGSTGPPKGVVHAHMDMIGHLITAR
HVLNVKEGTVIWTDGDPGWVTGTVYGAFAPWLCGATSVIQGDRFSASTWYRTLERHKVEI
WYTTPRTLTRLAEAGDDLPRRYDFSRLRHIATVGEMLRPDQFAWTRETLKLPPHDTWWMT
ETGMICIANYQSMSIKPGSMGKVIPGIEAAVLDENGEPLPPMTLGELALRPDWPALMTGI
WQDAARYQDYFRFRNWFLTGDMVTMDEDGYFFHYGRNDDLIKIGEKIIGPYEVEQVLAFH
PAVAEAVAISVGSASAKTYVKAFVMVSKGFTASASLNHQMKAFLKANISQDLPLADIEFM
EELPKTRSGKLLRRVLRAREKGLPSGDPARLKE
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagacaggaataccgccggacaaagaagaagcgaatctcgagacgtatgctgag
aaaggtacaagcttctcctgggcagagttggaacgggaattcacgtggtatgaatccggc
gagttgaacattgtacaggaagccttggacagatgggctcggctgagagatgaaaaatct
cgtaaagcgctgatttttgaaaaagccggtaaaaccttggtgttcacctatcaagaatta
cgggaatcatcgtgtcagtgggcaaacctcctcacagaatatgggttgactgtaggagat
cgcgtttttatctttctgccgccatgtcccgagatttacttcttgatgcttgcctgtgcg
cgtctgggtatcattttttcaccactctttcccgatctttcgtttgacgaacttgcgttt
cgcctgcaaaacgcaagaccgcggagtatcgtcactcatccggatcttatcgaacgactc
ccggaccatgcactgtccagcgtcgaacgcatctttctcactgaaggagccggagtcggt
ctctttcctaacgagttgccgatcaaagacatcatcggcacgctccctaggaagagcgct
attaaatgggtgaggggcaccactccgctgtacttgctgtacacgtcaggttccaccggc
cctcctaaaggtgtagtgcacgcccatatggatatgatcggccatttgatcaccgctcga
catgtgctgaatgtgaaggaggggacggtgatctggaccgacggagaccctggttgggta
accggtaccgtgtacggagcgttcgctccctggctctgcggagctacatcagtgatccaa
ggagatcgattctcggcatccacctggtacagaaccttggaacggcacaaggtggagatc
tggtacacgacgccgcgaaccttgacgcggctcgccgaagctggagacgatctgccccgg
cgatacgatttttcccgcttgcgccacattgcgacggtaggtgagatgctcaggcccgat
caatttgcttggacccgggaaacactgaagctgccgcctcacgacacatggtggatgacc
gagacaggaatgatatgcatagcaaattaccagtccatgagtatcaagccgggcagcatg
ggtaaggttattccgggaattgaggctgcagttctggacgagaatggcgaaccacttccc
ccgatgactctcggtgaacttgcattacgtccggattggccggcactcatgacaggaatc
tggcaggatgcagcccgttatcaagattacttccggttccgaaattggtttcttaccggt
gacatggttaccatggacgaagacggttatttctttcactacggccggaatgacgatctc
attaaaattggcgaaaagattataggaccgtatgaagtcgagcaggtccttgcgtttcat
ccggcagttgcagaagcagtagctatatctgtcgggtctgcatcagcaaagacgtatgtg
aaagcgtttgtcatggtgagcaaaggcttcacggcctcggcaagtctgaatcatcagatg
aaagcatttctgaaagcgaatatctctcaggacttgccgctcgctgatatcgagtttatg
gaagaattgcctaaaacacgatccggaaagttgctccgaagagtcttgcgtgcacgagaa
aagggattgccttccggagatcctgctcgattaaaggaatag

DBGET integrated database retrieval system