KEGG   Desulfomonile tiedjei: Desti_2540Help
Entry
Desti_2540        CDS       T02147                                 

Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00010  Glycolysis / Gluconeogenesis
dti00020  Citrate cycle (TCA cycle)
dti00620  Pyruvate metabolism
dti00633  Nitrotoluene degradation
dti00640  Propanoate metabolism
dti00650  Butanoate metabolism
dti00680  Methane metabolism
dti01100  Metabolic pathways
dti01120  Microbial metabolism in diverse environments
dti01130  Biosynthesis of antibiotics
dti01200  Carbon metabolism
Module
dti_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desti_2540
   00020 Citrate cycle (TCA cycle)
    Desti_2540
   00620 Pyruvate metabolism
    Desti_2540
   00640 Propanoate metabolism
    Desti_2540
   00650 Butanoate metabolism
    Desti_2540
  Energy metabolism
   00680 Methane metabolism
    Desti_2540
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Desti_2540
Enzymes [BR:dti01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Desti_2540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AFM25220
UniProt: I4C6M9
Position
complement(3023182..3024093)
Genome map
AA seq 303 aa AA seqDB search
MTTKAVKSLPKEEFILPGTRSCAACGLMLTYRHALKALDPGKTIVAVPASCMTVLHGVYP
ITPVKVICVNNPFAATGAAASGIVAGLRATGKTDYTVVAFAGDGGTYDIGIQSLSGAMER
GTDFIYICYDNEGYMNTGTQRSSASPAGAVTTTTPILAKLQHKKDMLKIVEAHRIPYVAS
ASPAYPLDLYDKVRSAKETAGSRYIEVHAPCPPGWGFPNKDLIKTGKLAVDTGIHVLYEI
RDGAFRLTSKSLQLAEKGRKKTVASYVKGQTRFRRITEEQIQQLQDFADIRWNEFLERHA
KGR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaaggcggttaagtctttaccaaaagaagaattcattctcccgggaacgcgt
tcttgcgcagcttgcggtctcatgctcacgtatcgccatgccttgaaagctctcgacccc
ggaaagactattgtggctgttcctgccagttgcatgacggttcttcacggagtttatccc
attactcccgtgaaagtgatctgcgtaaataatccctttgctgccacaggagctgccgca
tcgggcatagttgccggactacgggctacgggaaaaacggattacaccgttgttgccttt
gcaggagacggcggaacatacgatatcggcattcagtccctttcaggagccatggagagg
ggaaccgatttcatttatatctgctacgataatgaaggatatatgaatacgggcacccaa
cgatccagtgccagccctgccggagccgtaaccaccaccactcccatactcgcgaagctg
cagcataagaaggatatgttgaagatcgtggaggcacaccgtattccttatgttgcctct
gcctctcctgcgtatcctctggacctttacgacaaagtccgctcggccaaggaaaccgct
ggctccaggtatattgaagtacacgcaccgtgtcctccgggatggggtttccccaataag
gatttgataaaaaccggaaaattggcagtagatacgggtattcacgttctttacgaaata
cgtgacggtgcgttcaggcttacctcaaaatcattgcagcttgcggaaaaaggacggaag
aagaccgtagcgagttatgtcaaaggacagacccggttcaggagaattacggaagagcag
atccaacagttgcaggatttcgcggacattcgatggaatgaatttctggagagacacgcc
aaaggccggtga

DBGET integrated database retrieval system