KEGG   Desulfomonile tiedjei: Desti_2598Help
Entry
Desti_2598        CDS       T02147                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
dti  Desulfomonile tiedjei
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dti00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3087908..3089506
Genome map
AA seq 532 aa AA seqDB search
MIENKDKRTPGTVYLVGAGPGDPGLITVKGLEKIRSADVLVYDYLAGAAIIAEAKPEAEL
LYVGKKGKNHTLEQVDINELLIKKSREGKTVVRLKGGDPYVFGRGGEEAEELFAAGIPFE
VVPGVTSAVAAPAYAGIPVTHRDHASMVTFITGHENPEKEESAIDWDVLARNPGTLVFLM
GVKNLPNISESLISYGKAPTTPAALIRWGTLPEQVSLISTLSEIPREAERRGIQAPAVLV
VGTSVTLHDTLGWFEKKPLFGKRILVTRGSEQSRKMVQAISTCGGEAVLFPTIKFVPPTD
YEPLDSAIKNISAYDWIVFTSVNGVEKFFQRFFEISDDIRTLAGPRIGAIGPVTAESIRK
HRLRVDLLAKEFIAEGVLDMLPEGEVRGKRFLIPRAEKAREALPDGLRNMGGLVDVVTVY
RTVLPEDTDVARIKSMFADKKVHAATFTSSSTVSHFIEMMGSEDLSTLLNGTLIASIGPI
TSATLTEKGLPVHVEAKEYTIPGLVSALVEFYQSDRQKLHAECDECPEGAAQ
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgattgagaacaaagacaaacgaaccccgggaacagtgtatttggtgggcgcaggcccc
ggcgatcccggcctgatcacggtgaagggacttgaaaagatacgatctgcggatgtactc
gtgtatgactatctggctggggctgcgattattgctgaagccaaaccggaagcggaactg
ctctatgtagggaaaaaagggaaaaaccacaccctcgaacaggtggatattaacgaactt
ctgataaaaaagtcccgagaaggcaagaccgtcgttcgcctgaaaggcggagacccttat
gtatttggcaggggcggtgaagaagcggaagaactcttcgctgcgggaattcctttcgaa
gttgtccctggagtgacttcagcagttgcagctcccgcatatgcaggcattccggttact
caccgggatcacgcctccatggtgacgttcataaccggacatgaaaaccctgaaaaagag
gaatccgcaatagactgggatgtgctggccagaaatccgggaaccctggtttttctcatg
ggagtcaagaatctgccgaatatctccgaatccctcatcagctacggcaaggctccgacc
actccggcagctcttattcggtggggaaccttgccggaacaggtctcgctcatttcgacg
ctgtcagagattccccgggaagcggagcgccgaggaatccaagctcccgcggtccttgtc
gtaggtacctctgtgaccttgcatgataccttgggctggttcgaaaagaagccgcttttc
ggaaaacgcattctcgttacccgcggcagcgaacaatcacgcaaaatggtgcaggcaatt
tccacatgcggtggggaagcggtgctttttcccacaataaagttcgttccaccaacagat
tacgaaccgctggattctgcaatcaagaacatttccgcatatgattggatcgtctttacc
tccgttaatggtgtggagaaattcttccagcgttttttcgaaatctcggacgatatccgc
acattggcaggaccaaggatcggggcaatcgggccggttacagcggaatccatacggaag
catcggctgagagtggatctcttggcaaaagagttcatcgccgaaggtgtcctggacatg
cttcccgaaggagaggttcgaggaaagcgtttcttgattcccagggcagaaaaagcgagg
gaagcgctaccagacggtctcagaaatatgggcggccttgtggacgtggttactgtgtac
aggactgttttgcccgaagacactgatgttgcccgcatcaagtcaatgtttgcagacaag
aaagtgcacgcggcaactttcacgtcgtcatccacagtgagccatttcattgagatgatg
ggaagcgaagatttaagcacgctcttgaacggtaccctgatcgcctccataggaccgata
acctcggcaacacttacggaaaagggcctgccggttcacgtggaagcgaaagaatacacc
attcccggcctcgtaagcgccctcgtggaattttatcaaagcgataggcaaaagttacat
gcggaatgcgatgaatgccccgaaggggcagcccaatga

DBGET integrated database retrieval system