KEGG   Desulfomonile tiedjei: Desti_2627Help
Entry
Desti_2627        CDS       T02147                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dti  Desulfomonile tiedjei
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dti00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:dti00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3120422..3121471
Genome map
AA seq 349 aa AA seqDB search
MNLRDIGRLFILGFRGTEFSRELQSFLKDLNPSGVVLFSRNIKSPMQVAQLNHDLQVFGR
ASNGLFIGVDQEGGRVRRLKEGFTEFPPALELSSRPDPEASVRHFARRTAEELTLTGFNL
DFAPVMDVIGSPENLTSSVIGDRSFGFDPDKVARLGTTVIHEFRSKGIIPCCKHFPGHGG
TLVDSHVDLPMDTREFESIERLDLVPFRSAAKMQVEMMMTAHVLYPSMDKLLPATLSGAI
LNGLLRERLSYGGIVITDDLDMGAVADRYSVEDACTMAFTAGADLLLICNNPEKAFRARQ
RIFEALQSGEIPESRLMDSITRIEKLKSAYMSSLVPCDMSAARNQFGRS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttagagatatcggcagactcttcattctcggtttcagaggaactgagttttct
cgcgaactccagtcgtttctgaaagacctcaacccctcgggagtagttctcttctcccgc
aacatcaagtctcccatgcaggtagcgcaactgaatcacgacctccaggttttcgggcgc
gcctcgaatggccttttcataggagtggatcaggaggggggccgtgttcgccgcctgaaa
gagggattcacagaatttccgcctgccctcgaactctcttcgcgtcccgatccggaagct
tcggtgcgtcatttcgctcgcagaacggctgaagagctgacgcttacaggattcaatctt
gacttcgctcctgtgatggacgtgatcggcagtcccgaaaacctgacttcatcggtcatc
ggagacagatccttcggattcgatcccgacaaagtggctcgtttggggactactgttatt
catgagttccgttccaaagggattatcccgtgttgcaagcattttcccggacatggcggg
acgcttgtcgattcacatgtggacctgcccatggacacgagggaatttgaatcgattgag
cgcctggatctggttccgttccgctccgccgcgaaaatgcaggttgagatgatgatgact
gcccatgtactgtatccatcaatggataagctcttgcctgcgaccctgtccggtgcgatc
ctaaacggactgctcagagagagactctcctatggcgggatcgtgattactgacgatctt
gacatgggagccgttgcagaccgctattccgttgaagatgcatgtactatggcctttact
gcaggagcggatttgcttctcatctgcaacaatcctgagaaagcttttcgtgctcgtcaa
cgtatattcgaagctctgcaatccggagagattcccgagtcgaggctgatggattcgatt
acccgtatagaaaaactcaaatcagcatatatgagttccctcgtaccatgcgacatgtcc
gcagcaaggaatcagttcggacgttcctaa

DBGET integrated database retrieval system