KEGG   Desulfomonile tiedjei: Desti_2627Help
Entry
Desti_2627        CDS       T02147                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dti  Desulfomonile tiedjei
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Desti_2627
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Desti_2627
Enzymes [BR:dti01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Desti_2627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3120422..3121471
Genome map
AA seq 349 aa AA seqDB search
MNLRDIGRLFILGFRGTEFSRELQSFLKDLNPSGVVLFSRNIKSPMQVAQLNHDLQVFGR
ASNGLFIGVDQEGGRVRRLKEGFTEFPPALELSSRPDPEASVRHFARRTAEELTLTGFNL
DFAPVMDVIGSPENLTSSVIGDRSFGFDPDKVARLGTTVIHEFRSKGIIPCCKHFPGHGG
TLVDSHVDLPMDTREFESIERLDLVPFRSAAKMQVEMMMTAHVLYPSMDKLLPATLSGAI
LNGLLRERLSYGGIVITDDLDMGAVADRYSVEDACTMAFTAGADLLLICNNPEKAFRARQ
RIFEALQSGEIPESRLMDSITRIEKLKSAYMSSLVPCDMSAARNQFGRS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttagagatatcggcagactcttcattctcggtttcagaggaactgagttttct
cgcgaactccagtcgtttctgaaagacctcaacccctcgggagtagttctcttctcccgc
aacatcaagtctcccatgcaggtagcgcaactgaatcacgacctccaggttttcgggcgc
gcctcgaatggccttttcataggagtggatcaggaggggggccgtgttcgccgcctgaaa
gagggattcacagaatttccgcctgccctcgaactctcttcgcgtcccgatccggaagct
tcggtgcgtcatttcgctcgcagaacggctgaagagctgacgcttacaggattcaatctt
gacttcgctcctgtgatggacgtgatcggcagtcccgaaaacctgacttcatcggtcatc
ggagacagatccttcggattcgatcccgacaaagtggctcgtttggggactactgttatt
catgagttccgttccaaagggattatcccgtgttgcaagcattttcccggacatggcggg
acgcttgtcgattcacatgtggacctgcccatggacacgagggaatttgaatcgattgag
cgcctggatctggttccgttccgctccgccgcgaaaatgcaggttgagatgatgatgact
gcccatgtactgtatccatcaatggataagctcttgcctgcgaccctgtccggtgcgatc
ctaaacggactgctcagagagagactctcctatggcgggatcgtgattactgacgatctt
gacatgggagccgttgcagaccgctattccgttgaagatgcatgtactatggcctttact
gcaggagcggatttgcttctcatctgcaacaatcctgagaaagcttttcgtgctcgtcaa
cgtatattcgaagctctgcaatccggagagattcccgagtcgaggctgatggattcgatt
acccgtatagaaaaactcaaatcagcatatatgagttccctcgtaccatgcgacatgtcc
gcagcaaggaatcagttcggacgttcctaa

DBGET integrated database retrieval system