KEGG   Desulfomonile tiedjei: Desti_2694Help
Entry
Desti_2694        CDS       T02147                                 

Definition
(GenBank) hypothetical protein
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00010  Glycolysis / Gluconeogenesis
dti01100  Metabolic pathways
dti01110  Biosynthesis of secondary metabolites
dti01120  Microbial metabolism in diverse environments
dti01130  Biosynthesis of antibiotics
dti01200  Carbon metabolism
dti01230  Biosynthesis of amino acids
Module
dti_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desti_2694
Enzymes [BR:dti01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Desti_2694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Semialdhyde_dh Pertussis_S2S3
Motif
Other DBs
NCBI-ProteinID: AFM25372
UniProt: I4C731
Position
complement(3194712..3195785)
Genome map
AA seq 357 aa AA seqDB search
MAKEKGVIHVVGTGTIGEPLIGLLCSFKDQAGFSEVTFHKRSPLPRDVPKIKALVARGAK
LSVDEDKINDFETLGLKPVMLHEEALAKADVVVDCTPSGVGISNKHEFYEKYLATTKGFI
AQGSEFGFGKMYARGINDDALEVGNDRFVQVVSCNTHNLCALINTVALTDGDDNLEEARF
LCIRRANDISQTKGFVPSPDVGKHGDPVFGTHHARDAYHLFRTKGLDLNLWSSALKLNTQ
YMHCIYFTLNLKRAVTKDEVIARFRADDRISLTQKQSACEVFSFGRDHGYFGRILNQTVI
VVPSLEVRKGHEVVGFCFTPQDGNSLLSSFSAVTWFLDPTNYVERTQCLKTYFFSEV
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagaaaagggtgtaatccatgtcgtgggtacagggaccataggagagcccctc
ataggtttgttgtgttcgtttaaggatcaagctggtttttcggaagtgactttccacaag
agatctcctttgccgagagacgttccgaaaattaaagctttagtggctcgaggagccaag
ctctctgttgatgaagataaaattaacgatttcgagacgctcgggttaaaacctgtcatg
ctgcatgaagaagctttggccaaagccgatgtcgtagtcgattgtactccgtctggggtc
ggcatttcgaataaacacgagttttatgaaaaatacctggccacaacaaagggattcata
gcccagggcagtgaattcggtttcggaaaaatgtatgccagaggcatcaatgatgatgct
ttagaagtgggaaacgaccgttttgttcaggtcgtgagttgtaatacccataacttatgt
gcgctcatcaataccgtagcgttgacggatggagacgacaatctcgaagaagcgcgattc
ctctgcatcaggcgagcaaacgatatcagccaaacaaagggcttcgttccgtctccggat
gtgggcaagcatggagaccccgtgttcggcacgcaccacgctcgagacgcatatcatctc
ttcagaacaaagggactggatctgaatctctggtcatcggcattgaagctgaatactcag
tatatgcactgcatatatttcacgctcaatctaaaacgggcggtcaccaaggacgaagtt
attgcgcgtttcagagccgacgaccgaatcagcctgacacagaaacagtccgcatgcgaa
gtcttctcgttcggccgggatcatggatattttggcaggattctcaatcaaacggttatc
gtggtaccttcgctggaagttcgcaaaggccacgaagtagtcggattctgtttcactccg
caggacgggaactcactgttgagttccttcagcgcggtaacgtggttcctggatccgacc
aactatgtcgagcgcacgcagtgcctcaaaacatacttcttctcagaggtgtaa

DBGET integrated database retrieval system