KEGG   Desulfomonile tiedjei: Desti_2703Help
Entry
Desti_2703        CDS       T02147                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00010  Glycolysis / Gluconeogenesis
dti00030  Pentose phosphate pathway
dti00051  Fructose and mannose metabolism
dti00052  Galactose metabolism
dti00680  Methane metabolism
dti01100  Metabolic pathways
dti01110  Biosynthesis of secondary metabolites
dti01120  Microbial metabolism in diverse environments
dti01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desti_2703
   00030 Pentose phosphate pathway
    Desti_2703
   00051 Fructose and mannose metabolism
    Desti_2703
   00052 Galactose metabolism
    Desti_2703
  Energy metabolism
   00680 Methane metabolism
    Desti_2703
Enzymes [BR:dti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desti_2703
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Desti_2703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AFM25380
UniProt: I4C739
Position
3203601..3204815
Genome map
AA seq 404 aa AA seqDB search
MEKLTGKAIIAMGGGPTAVINQSLVGAVLQARQYSHITQFYGAFRGVEGLVEEQMVNLSE
ATSHNLEMVGKTPGAGIRSTRLKPDEEFCSRIFKVCKAHGIHYFFYIGGNDSAETCRIVN
TFAREEGYEMRVLHIPKTIDNDLRVTDHCPGYGSAAKFVAQAFMGVNLDNRSLPGVYVGV
VMGRHAGFLTAASVFARKYDDDGPHLIYVPEKPFSSDEFLASVDEMYTKYGRAIIAVSEG
IQDEHGKPVIAGLVKEIERDAHGNIQLSGSTSLGDALTGLVREKLKIKRVRSDTFGYLQR
SFLGCVSEVDAHEAREVGERAVQIAAWHSADGSITIERVGDYGVRYNLTPLQEVAKETKS
MPDEFIQGANNVTTEFKNYARPLLGEIPVYDRIHAPRVEKILNP
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattaaccggcaaagccattatagcaatgggcggcggccccaccgcagtcatc
aaccagtcactggtgggagctgtgctacaggcccgccagtattcccatatcacccaattt
tacggagcgtttcgtggtgtcgagggcctggttgaagaacagatggtcaatctctctgaa
gcgacaagccacaatcttgaaatggtaggaaaaacaccgggtgccggaatccggagcacg
cgtctgaagccggatgaggaattctgcagccgcattttcaaggtatgcaaagcgcacggt
atccattatttcttctatattggcggcaacgactctgcggaaacctgccgcatcgtgaac
accttcgcccgcgaagaaggttacgagatgcgtgtattgcacattccgaagacaatcgat
aacgatcttcgggtgaccgatcattgtccgggatatggatctgcagcgaaattcgttgcc
caggcctttatgggtgtcaaccttgacaaccgatctttgcccggtgtgtacgtaggtgtc
gttatgggacggcatgcaggatttcttacggcagcatcggttttcgcccgcaaatacgac
gatgacggcccccatttgatttacgttccggaaaagccgttcagttcggatgaattcctg
gccagtgtcgatgaaatgtataccaagtacggacgagcaataatagccgtgtcggaagga
attcaagacgagcatggcaaaccggtaattgcaggccttgtgaaggaaatcgagcgggat
gctcacgggaatattcagttgtccggaagcacttctttgggagatgccttgaccggactg
gtccgtgaaaaactgaaaatcaaacgtgtgcgttcggacacattcggctatctgcaaaga
tctttcctgggttgtgtcagcgaagtcgatgcgcatgaggcccgagaagtaggcgaacgg
gccgtccagattgctgcatggcatagcgccgacggctccattaccatcgaacgagtcggc
gattacggggtaaggtataatttgaccccgctgcaggaagtggcaaaagaaaccaagtca
atgcccgatgaatttatccaaggagcaaacaacgtaacgaccgaattcaagaattacgcg
agacctctcctgggagagattcccgtatacgacagaatacacgccccacgagtcgagaaa
atcttgaatccttga

DBGET integrated database retrieval system