KEGG   Desulfomonile tiedjei: Desti_2703Help
Entry
Desti_2703        CDS       T02147                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dti  Desulfomonile tiedjei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:dti01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dti01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dti00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dti00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dti00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dti00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:dti00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3203601..3204815
Genome map
AA seq 404 aa AA seqDB search
MEKLTGKAIIAMGGGPTAVINQSLVGAVLQARQYSHITQFYGAFRGVEGLVEEQMVNLSE
ATSHNLEMVGKTPGAGIRSTRLKPDEEFCSRIFKVCKAHGIHYFFYIGGNDSAETCRIVN
TFAREEGYEMRVLHIPKTIDNDLRVTDHCPGYGSAAKFVAQAFMGVNLDNRSLPGVYVGV
VMGRHAGFLTAASVFARKYDDDGPHLIYVPEKPFSSDEFLASVDEMYTKYGRAIIAVSEG
IQDEHGKPVIAGLVKEIERDAHGNIQLSGSTSLGDALTGLVREKLKIKRVRSDTFGYLQR
SFLGCVSEVDAHEAREVGERAVQIAAWHSADGSITIERVGDYGVRYNLTPLQEVAKETKS
MPDEFIQGANNVTTEFKNYARPLLGEIPVYDRIHAPRVEKILNP
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattaaccggcaaagccattatagcaatgggcggcggccccaccgcagtcatc
aaccagtcactggtgggagctgtgctacaggcccgccagtattcccatatcacccaattt
tacggagcgtttcgtggtgtcgagggcctggttgaagaacagatggtcaatctctctgaa
gcgacaagccacaatcttgaaatggtaggaaaaacaccgggtgccggaatccggagcacg
cgtctgaagccggatgaggaattctgcagccgcattttcaaggtatgcaaagcgcacggt
atccattatttcttctatattggcggcaacgactctgcggaaacctgccgcatcgtgaac
accttcgcccgcgaagaaggttacgagatgcgtgtattgcacattccgaagacaatcgat
aacgatcttcgggtgaccgatcattgtccgggatatggatctgcagcgaaattcgttgcc
caggcctttatgggtgtcaaccttgacaaccgatctttgcccggtgtgtacgtaggtgtc
gttatgggacggcatgcaggatttcttacggcagcatcggttttcgcccgcaaatacgac
gatgacggcccccatttgatttacgttccggaaaagccgttcagttcggatgaattcctg
gccagtgtcgatgaaatgtataccaagtacggacgagcaataatagccgtgtcggaagga
attcaagacgagcatggcaaaccggtaattgcaggccttgtgaaggaaatcgagcgggat
gctcacgggaatattcagttgtccggaagcacttctttgggagatgccttgaccggactg
gtccgtgaaaaactgaaaatcaaacgtgtgcgttcggacacattcggctatctgcaaaga
tctttcctgggttgtgtcagcgaagtcgatgcgcatgaggcccgagaagtaggcgaacgg
gccgtccagattgctgcatggcatagcgccgacggctccattaccatcgaacgagtcggc
gattacggggtaaggtataatttgaccccgctgcaggaagtggcaaaagaaaccaagtca
atgcccgatgaatttatccaaggagcaaacaacgtaacgaccgaattcaagaattacgcg
agacctctcctgggagagattcccgtatacgacagaatacacgccccacgagtcgagaaa
atcttgaatccttga

DBGET integrated database retrieval system