KEGG   Desulfomonile tiedjei: Desti_3254Help
Entry
Desti_3254        CDS       T02147                                 

Definition
nicotinamidase-like amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
dti  Desulfomonile tiedjei
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Desti_3254
Enzymes [BR:dti01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Desti_3254
    3.5.1.-  
     Desti_3254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3822414..3823112
Genome map
AA seq 232 aa AA seqDB search
MREVGFVLTLAFFVGASILMAVQTGFCKDIVGVIVVDMQGDFTTLKNGALAVNGTDKAFV
ERVQKATEALKQKGCTIFATQDWHPKDHISFFTNHEGKKPFEAIQIEGRTQVLWPPHCVQ
ETDNAALLLDKSLFAAVVKKGQDKKYDSYSGFQDDGGKQTEMAKILKESGIKELIVYGIA
TDYCVKATAIDAAKEGFKVTVIENLCRGVAPETSAKAIQEMKDKGITVKQEL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagggaagtaggctttgttctcacgttggcattctttgttggagcttcgattctaatg
gccgttcaaacaggtttctgtaaagacatcgtgggcgttatagtcgttgatatgcaaggt
gatttcactacgttaaagaacggggcacttgcagtcaacggaaccgacaaggcctttgtg
gaacgggtgcaaaaggccaccgaagccttgaagcaaaaagggtgtaccatttttgccact
caggactggcacccgaaagaccacatttcgttcttcacgaatcacgaaggcaaaaaaccg
tttgaggctatccagatagagggcaggactcaggtgctctggccgcctcattgtgttcag
gaaacggacaatgccgctctcctgctggataagagcctgtttgccgctgttgttaaaaag
ggccaggacaaaaaatatgacagctattccggctttcaggatgatggtggaaaacagacc
gaaatggccaaaatcctgaaagaaagcgggatcaaggagctcattgtctacggcatagcc
acggattattgcgtgaaggctacagccattgacgcagccaaagaaggattcaaagttacc
gttattgaaaacttgtgccggggggtggctcctgaaacatccgccaaagctattcaggaa
atgaaagacaaaggcataaccgtcaaacaggagctgtaa

DBGET integrated database retrieval system