KEGG   Desulfomonile tiedjei: Desti_3268Help
Entry
Desti_3268        CDS       T02147                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00900  Terpenoid backbone biosynthesis
dti01100  Metabolic pathways
dti01110  Biosynthesis of secondary metabolites
dti01130  Biosynthesis of antibiotics
Module
dti_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Desti_3268
Enzymes [BR:dti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Desti_3268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AFM25926
UniProt: I4C8N5
Position
complement(3842786..3843643)
Genome map
AA seq 285 aa AA seqDB search
MRKIRATTPAKINLFLQVLDRRPDGYHTIETLYQAISLRDELIVEKSSGPCKLDVIGAAQ
LKSDDNLVIRALRWMEDRVGCRIPVKIRLTKQIPIAAGLGGGSSNAAGMLLALRELFQFR
VSDQDLRTGAEELGADITFFFSGGSAVGEGIGEIVTPVKIASDYRIMLVNPGFPVSTARV
YREFSRNLTGNPVEGRLWSVLRESTDVCDILHNDLQPVSESLYPEILEIGKRLEDKGFKH
VLMSGSGPTFFALVPRGESIPVNFSFPAEWIILEASPELNGIVLD
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaagatacgagcgacaactcctgccaaaatcaacttgttcctgcaggttctcgat
cgtcgtccggatggataccataccattgagaccttgtaccaggcaatcagcctgcgtgac
gaattgatcgtagagaaatcctcaggtccctgcaaacttgatgtaatcggtgcagctcaa
ctaaaatcggatgataacctggtaatcagagcgctcaggtggatggaagatcgtgtaggc
tgtcggatacccgttaagatacgtctaaccaagcagataccgattgctgcgggtcttggt
ggcggaagttccaatgcggccggaatgcttcttgccctgcgggagctgtttcagttccgg
gtctcggatcaggatctgcgcacgggggctgaagaactgggtgctgatatcacttttttc
ttcagcgggggatctgcagtgggagagggcatcggcgaaattgtcacgccggtgaaaatt
gcttctgactaccgtatcatgctggttaacccgggatttcccgtctccaccgccagagta
taccgtgagttttccaggaacttgacaggcaatcccgtggagggtagattgtggtcggtg
ctgcgggagtccacggacgtgtgtgacattctccacaacgacctgcagcccgtgagcgag
tctttgtatcccgagattcttgaaataggtaagcgtctcgaggataagggattcaagcac
gtactcatgtccggaagcggtccgacctttttcgctttggttccccggggagaatcgatc
ccggtaaacttttcgtttccagcggaatggattatcctggaagcgtcaccggaactgaac
gggatcgtgctggactga

DBGET integrated database retrieval system