KEGG   Desulfomonile tiedjei: Desti_3611Help
Entry
Desti_3611        CDS       T02147                                 

Definition
asparagine synthase, glutamine-hydrolyzing
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dti  Desulfomonile tiedjei
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Desti_3611
Enzymes [BR:dti01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Desti_3611
Peptidases [BR:dti01002]
 Cysteine Peptidases
  Family C44
   Desti_3611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4238897..4240780)
Genome map
AA seq 627 aa AA seqDB search
MCGICGIFLLKTGANADRELLQRMNRTMVHRGPDDEGYYVAGSVGLAMRRLSIIDLTTGK
QPICNEDESLWIVFNGEIYNYPELREDLIARGHTFKTRSDTEVIVHLYEELGERCVEPLN
GMFSFAIWDNANRKLFLARDRLGIKPLFYSFIPGKALYFGSEIKAILKAPVPRNPDYQGL
YDYLSLMYIPTPATAFESVKKLPPGHVLSCDAHGINIRKFWDVPLPALGDENSSNKDYEE
EVLHLIQTAIKRQMISDVPIGALLSGGLDSTTVAAVMSRKLGMPLHTFTIGFDRKSYDES
QEARLVAQTLGTDHLEQIVHPGMIESIPELLTFFDEPFADYSAIPTFLVSRLAAQHVKVV
LTGDGGDEVFAGYPTHVAYRVSRLFRIIPRWVRNGIITPAVMALPTSLERISFDYKAKRF
VTGAELSLEQGHYWWKVIFNEEEKRSLCSPGFLENGFRDSFHSFETHFEACRHAHPLNRL
LYVDTKTFLLDDNLAKVDRMTMANSLEARVPLLDHEIVERVALMPPHVKSRGLQTKRLLR
RAVRKLLPPEIRKGKKKGFTPPLPFWIQKELRGFLEDLFSEKRLAQCGMLDRKECRRILH
EHLTGKKDNNRQIWTIVALICWLEKYA
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatttgcggaatttttctcctgaaaaccggcgcgaatgctgacagggaattg
ctccagcggatgaaccgaaccatggtgcatcgcggtcccgatgacgaaggatactatgtg
gccggttctgtcgggcttgcaatgcgcaggttgagtatcatcgacctgacaacaggcaag
caacccatatgcaatgaagacgagagcctctggatcgtttttaacggagagatttacaac
tacccggaattacgtgaagacctgatcgcccgcggccatacgttcaaaacaagatccgat
accgaagtcatagtccacctgtacgaagaattgggcgaacgttgcgtcgagccgcttaat
ggtatgttctccttcgcaatatgggataatgcaaacagaaagctcttcctggctcgtgac
cgcctcgggataaagccgttattttactctttcatccctggaaaggccctgtatttcggc
agtgagatcaaagcgattctcaaggctcccgtgccgcgaaatcccgattatcagggtcta
tatgattacctttctctgatgtacattcccacgcctgccactgcgtttgagtccgtgaag
aaacttccgccgggacatgtgcttagctgcgatgcacatggcatcaatatccgaaaattc
tgggacgttccgcttccggcacttggagatgaaaattcctcgaacaaagattacgaggaa
gaggtgttgcacctgatccagacggccataaagcgtcagatgatctccgacgtccccata
ggagcccttctcagcggcggtctcgattccactaccgtggcagcggtaatgtcccgcaag
cttggaatgcctcttcacacgtttaccataggatttgaccgaaaatcgtacgacgaatcc
caggaagccagattggtagcacagacgctcgggacggatcacctggaacagatcgtacat
ccgggtatgatcgaatccatacccgaactgctcacgttctttgacgaaccattcgctgac
tattccgctatccccaccttccttgtgtcacgattggctgcacagcatgtcaaagtcgtc
ctcacaggggacgggggagatgaggttttcgctggctaccctacgcatgtggcataccga
gtcagcaggttatttcgtatcattcctcgatgggtgcggaacggaataattacgcctgct
gtcatggctcttcccacttccctggagcgaatcagtttcgactacaaagccaagcgattc
gtcacaggggctgaactttctctcgagcagggccactactggtggaaggtaattttcaat
gaagaggaaaagagatctctgtgctccccgggttttcttgagaatggcttcagagacagt
tttcattcttttgagactcactttgaagcatgcaggcatgcgcatcctctgaatcgcctc
ctctatgtggataccaagacgttcctgttggatgacaatctcgcaaaagtcgaccgtatg
actatggctaattccttggaagcgagggttccactgctggatcatgaaatagtggaacgg
gtcgcgctcatgcctccgcatgtcaaatcgcgtgggctccagaccaaaagacttctccgg
agagcggtgcggaaactcctgccaccggaaatacgaaaagggaagaagaaaggcttcacg
ccaccgctgcctttctggattcagaaggaactaagaggatttctggaagacctgttttcc
gagaaaaggctggcacagtgcgggatgctcgatagaaaagaatgccgaagaattcttcac
gagcacctgacaggaaagaaagacaacaacagacaaatatggaccatcgtcgccctcata
tgctggctggaaaaatacgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system