KEGG   Desulfomonile tiedjei: Desti_3884Help
Entry
Desti_3884        CDS       T02147                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dti  Desulfomonile tiedjei
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Desti_3884
Enzymes [BR:dti01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Desti_3884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4537403..4538257
Genome map
AA seq 284 aa AA seqDB search
MHNVQFLASSAREVLPGRPAILGCPLDVTSTYRSGSDIAPNAIRRASDSIETYSPFLDMD
LEDRPFSDLGDLDIAGQLLDSSLDLMEQAASTIHAKGGRLLALGGEHTITLPLVKSLHAS
FPDLVLIHADAHSDLRDEYEGRPINHATVIKRISEIIGADRLIQLGIRSGTREEFAWMHE
NGTLLTWDASSAKELAKRVAGRPVYFTLDLDVLDPSCLHATGNPEPGGWFYSDMERLFQA
LRKMRLIAADVVELNPQLDPSQVGTITASKIVRELLLILGTTGI
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcataacgttcagtttctcgcctcatccgctcgggaagtgcttccgggccgacctgcc
attctcggatgtccgctcgatgtgacgtccacatatcggagcggctcggatattgctccg
aatgccatacgaagggcttcagattccattgagacctattccccttttcttgacatggat
ctggaagatcggcctttcagcgatctcggggacctcgacattgccggtcaattactcgat
tcttcactcgatttaatggagcaggcggcgtcgactatccacgcgaaaggtggacgacta
ttggcgttggggggggaacacacgattacacttcctcttgtgaagtctttgcacgcgagc
tttcccgatctcgtgctcattcatgctgacgcgcattcggacttgagagacgagtacgag
gggcggcccattaaccatgcaacagtcattaagagaatatccgagataatcggagccgac
cggttaattcagctcggaatcagatccggtacgcgcgaagaattcgcatggatgcacgaa
aacggaaccctgctcacgtgggacgcgtcaagtgcaaaagagctggcaaagcgtgtcgct
ggacggccggtgtacttcaccctggatctcgatgtgctcgatccttcttgcttgcatgca
acgggaaatcccgaacccgggggatggttttacagcgatatggagcgcttatttcaggcg
ctccgcaaaatgcgattgattgccgcagatgtggtggagttaaatccgcagttggaccca
tctcaagtgggcactataacggcatccaaaatcgtacgcgagctgttgctgattctcggt
actaccgggatataa

DBGET integrated database retrieval system