KEGG   Desulfomonile tiedjei: Desti_3909Help
Entry
Desti_3909        CDS       T02147                                 

Definition
sugar kinase, ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dti  Desulfomonile tiedjei
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Desti_3909
Enzymes [BR:dti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Desti_3909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4562334..4563356
Genome map
AA seq 340 aa AA seqDB search
MKLDVIGFGSLNLDEIWEVPREFLRVHDLPLGEEYVRDVNWFARFYPELRKHGIMMDTTP
GGSAANTIAALRKLGFSTGFYGCAGESDLTALKLEDLGRPKDLRIHTVPVAAGRCLALID
AEDSLKDRVLLILPNANDMAGSEDLDTAYFLNASWLHLTSFVARDPLDAQMNLAASVHGN
TQISFDPGAIYSCLGMSTLEPLLRRTDVLFSSVEELEQLTSVNGVENAVDTLMKLGIEII
VVKMGEKGLKAFSRDRAVSQPPIPARTIKDRTGAGDVAAAGFLAGMLLSLNIEECAELAA
ITASRSIEGFGRNAYPDRSVLETMLSRGQAAGSKHVQQDA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcttgacgtaatcggcttcggatcgctgaatcttgacgaaatatgggaagtgccc
agggaattcttacgagttcacgatctccccctcggtgaggaatacgtgcgcgacgtgaac
tggttcgcacggttctatcccgagttgcgcaaacacggaatcatgatggacacgacacct
ggaggttccgctgcaaacaccatagcggcattacgaaaactggggttttccacgggattc
tatggctgtgccggtgagtccgatctgactgcgttgaagctggaagaccttggaaggccg
aaggatctgagaattcatacagttccggttgcagcgggaagatgcctggctctcatagac
gctgaagactccctaaaagacagggtgctgcttattttgccgaacgccaacgatatggca
gggtccgaagatctggacacggcatacttcctgaatgcgtcatggctccatttaacgtcc
tttgtcgcacgagatcctctggatgcccagatgaatcttgctgcaagcgtgcacgggaac
acccaaatcagcttcgatcccggagcgatctacagttgcctcggcatgagcacactcgag
cctcttctcagaagaaccgatgtactcttctcaagcgtagaggaattggagcaactgact
tcagtgaacggagttgaaaatgccgtcgacacgcttatgaaattggggattgaaattatt
gtcgtaaaaatgggtgaaaaaggactgaaagctttttcacgagatcgtgcagtatctcag
cccccaattccggcacgtacgatcaaagaccggacaggggcaggagatgtcgctgctgcg
ggtttcttggcggggatgttgctgtctctcaatattgaggaatgtgctgaattggctgcg
attacagcatccaggagtattgaaggatttggccgcaacgcgtatcctgatcgatccgtt
ctcgaaacaatgttgtcccgggggcaagcagccgggagcaagcacgtacagcaagatgct
tag

DBGET integrated database retrieval system