KEGG   Desulfomonile tiedjei: Desti_3991Help
Entry
Desti_3991        CDS       T02147                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dti  Desulfomonile tiedjei
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Desti_3991
Enzymes [BR:dti01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Desti_3991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4655028..4656362)
Genome map
AA seq 444 aa AA seqDB search
MCAEIAVIGAGIAGLAAAHFLSRAGHHVVVFEKNSFAGGRMSSEVVDGFVVEKAAYTYPE
FHRNLTKFLGDLGTGNALVETPGTSSTFARGREYQIKIGSPKDFFTYKLLSLRNKKDMVK
LFLYAQSLGAALNLADPTAKTLELEQESSADYLLTHYDEDILELIAYPIFCEIFLGTPEG
NSKLAFLSTIKNLTRFKIFSFERGMGMLPERLAATLDVRLSTPVLDVRRAAGRNAYAISV
GGDRSGTNLYDAVILAIPAPIVPLLCPDLSAEIKTRLNAIVYAPSIVAVFALSRVREGTS
MISNLVRKDFKTVGTLVFDRHKGMSHVPDGKEMITAILCEDASRALFDAPDDAVERAALA
EISGLYPGLSEQVLFSRVYRWEHGAVQLPPGAVSRSHSLRKALEEQYDDLIIAGDGLYKS
SLEVSFNSGVKAAERLIRKFGRLQ
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgctgaaattgccgttattggcgcaggaattgccggcttggctgctgcgcacttc
ctgagccgcgccggccatcatgtcgtagtcttcgagaagaattctttcgctggcggccga
atgagttctgaggttgtggacgggttcgttgtcgagaaggctgcctatacctatccggaa
tttcaccggaatctcacaaaatttcttggagacctcggcacaggtaacgcgttggtagag
acacccggtacatcatccacgtttgcccgaggtcgcgagtatcagatcaaaatcgggtca
ccgaaagatttctttacgtacaaacttctctcgttacgtaataagaaagacatggtgaag
ttgttcctttacgcacagtcactcggtgcagcgttgaaccttgcagacccgacggcaaaa
accctcgaattggagcaggaatcgtcagccgactacctgctcacccactatgacgaagac
atcctcgagttgattgcataccctattttctgtgaaatcttcctcggtactccggaaggc
aactccaaacttgcctttctctctactatcaagaatctcactcgatttaagatattttca
ttcgaacgcggtatgggtatgctgccggaacgacttgcggcaactttggatgtgcgtctc
tctacgccagtcctggatgtgcgccgtgcggccggacgaaatgcgtacgcaatctcggtt
ggtggagatagatcagggacaaatttgtatgatgctgttattctcgcgattccagcaccc
attgtcccgctgctctgtcccgacttatcagccgagataaagactcgcctgaacgcaatc
gtgtacgctccatctatagtggcggtattcgctctgagtagagtgcgtgagggcacgtcg
atgatctcaaatctggttcgaaaggatttcaaaactgtagggaccctggtttttgaccgt
cacaagggaatgtcgcacgtgccggacggcaaggagatgatcacagcaatcctttgcgaa
gacgcgagtcgcgctttattcgatgcacctgacgatgcagtggaacgcgcagcgctcgcc
gaaataagcggtctatatcccggcttgtcagaacaggtgcttttctcgcgggtatatcgt
tgggagcatggagcagttcaacttccacccggagcggtttcccggtcccattcgctaagg
aaagcccttgaagagcagtatgacgatctgattattgcaggcgacggactgtacaagtcg
agtctcgaagtgagcttcaactcgggtgttaaagctgcagaacgattgatccgcaagttc
ggacggttacagtga

DBGET integrated database retrieval system