KEGG   Desulfomonile tiedjei: Desti_4047Help
Entry
Desti_4047        CDS       T02147                                 

Definition
(RefSeq) succinyl-CoA synthetase (ADP-forming) beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dti  Desulfomonile tiedjei
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desti_4047
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desti_4047
   00640 Propanoate metabolism
    Desti_4047
   00660 C5-Branched dibasic acid metabolism
    Desti_4047
Enzymes [BR:dti01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Desti_4047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4711647..4712810
Genome map
AA seq 387 aa AA seqDB search
MNLHEYQAKEILAKRGVPIPRGSVCYDPLEAQIAARELKTEKVVLKAQAHTGGRGKAGGV
ALVSAEGDIRTKASEILGRQLVTYQTGPEGKPVSALLVEEVLPIDREMYLGAVLDRTSGK
VTIMASSEGGVEIEKLARESPEKIITIAVDPLRGLTPFQARLLAYKLSDNKIHAQQIAKT
VSAVYDVFIKYDCTLAEINPLIVSGDKVLALDAKINLDENALFRHPELESMRDRSQEDLL
ELSARKDGLSYIKLTGDIGCIVNGAGLAMATLDLIALHGGSPANFLDVGGGASEQGVADA
MNILLDDRRVKVVFINIFGGILRCDVLARGVIKALNARGVALPIVARIEGTNIEEGRELF
EQSGLPIEMIPSLDEAARLVVAKAKSL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgaatatcaggcaaaagaaatcctggcaaagcgaggggtacctattccc
agaggctcggtttgttacgatcccctggaagcacagattgccgcacgggaattgaaaact
gaaaaggtggttctcaaggcacaggcgcatacaggcggcagaggaaaggccggcggtgtt
gcactcgtctccgcagaaggcgatatcaggactaaagcatcggaaatcttgggacgccag
ttggtgacctaccagaccggaccggaaggcaaaccggtgagcgctctgttggtagaagaa
gtccttcccatcgaccgggaaatgtatctcggtgccgtcctggacaggacttccggcaaa
gtcacgattatggcgagttctgaaggcggtgtggaaatcgagaagcttgcccgggaatca
ccggaaaagattatcacgatcgcggtcgatccgctgcgaggactcacgccttttcaggca
agactcctggcatacaagctgagcgacaacaagattcatgcacagcaaatagcgaaaacg
gtcagtgcagtgtacgacgtgttcataaagtacgattgcactctcgcggagataaatccg
ttgatcgtttcaggggacaaggttctcgccctggatgccaagatcaacctggatgaaaat
gccctgttccgacatccggaactggaatcgatgcgagacaggtcccaggaagatttgctc
gaactgtctgcaagaaaagacggattgagctatatcaagctgaccggcgatatcggttgt
atcgtcaatggagccggtctcgctatggccacgcttgatttgatcgctctccacgggggc
tctcccgctaattttctggatgtaggaggcggagcaagcgagcagggcgtggcagacgcg
atgaatattcttctggacgaccggcgggtaaaggtagttttcattaatatattcggtggc
atattgcggtgcgatgtgctggcccgaggcgttatcaaagcattaaacgcccgcggagta
gcgctccctattgttgctcgaattgaaggaaccaacatcgaagaaggccgcgaactgttt
gagcaatccggtcttcccatagagatgataccgtccctggacgaagccgcacgactggtg
gttgccaaggccaagtccctttag

DBGET integrated database retrieval system