KEGG   Desulfomonile tiedjei: Desti_4114Help
Entry
Desti_4114        CDS       T02147                                 

Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dti  Desulfomonile tiedjei
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desti_4114
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desti_4114
Enzymes [BR:dti01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Desti_4114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4786467..4787246
Genome map
AA seq 259 aa AA seqDB search
MSGFLQKIVKIKAERLALQIAHANAGALEAQARLASPPKAFLDAFRGPGIHIIAEIKRAS
PSKGLLNADLEPASLARTYASGGACAISVLTEEDHFRGSLSDLKEVRRAVPLPILRKDFI
LEPFQIFEARLAGADSILLIAAVLDEGTLKSLIELSRSMAMEPLVEIHDKYELSMALNVG
AGLIGINNRDLRTFGTDLNVTVKLAGLIPSDRTIISESGIRTHQDISRLRDAGVHGFLIG
ETLVKSPDPEAALQELLHA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtccggatttttgcagaaaattgtcaaaatcaaagccgaacgactcgcgcttcaaatc
gctcatgcaaatgcaggagcattggaggcgcaagccaggctggcatctccgccgaaggca
tttctcgatgcttttagaggaccgggaatacatatcattgctgagatcaaaagagcatcg
ccatcgaaaggtttgctgaatgctgacttggaacccgctagccttgctcgaacctatgca
tcaggtggggcttgtgcgatttcggtccttacagaggaagaccattttcgcgggagtctt
tcagaccttaaggaagttcgcagagcggtcccgctgccgatcctccgaaaggatttcatc
ctggaacctttccaaatttttgaagctcggcttgccggagcagattctattctccttatt
gccgccgtcctggatgaagggactttgaaatcactcattgagttgagccgaagcatggcc
atggaaccgttagtggaaatccatgacaaatacgaactcagtatggcacttaacgtcggc
gccgggttgatcggtatcaacaaccgcgatctgaggacgttcgggaccgatctgaatgtt
accgtgaaactcgcgggcctcattccaagcgacagaacaatcatatcggagagtggcatt
cgcactcaccaggatatctcacgtttgcgggacgccggggtgcacggttttcttataggc
gaaacgctcgtgaaatcccctgatccggaagccgcgcttcaggagctgttacatgcttga

DBGET integrated database retrieval system