KEGG   Desulfomonile tiedjei: Desti_4116Help
Entry
Desti_4116        CDS       T02147                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dti  Desulfomonile tiedjei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desti_4116
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desti_4116
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desti_4116
Enzymes [BR:dti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desti_4116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4787861..4789075
Genome map
AA seq 404 aa AA seqDB search
MRCTAQPALDTVPDIKGYYGQFGGRFVPEILITPLLELEEVFLDIVHSPDFSQRLIRLLE
TYAGRETPLFQASRLAAKWGKAKLYLKREDLLHTGAHKINNTLGQALLARHMGKRNVIAE
TGAGQHGVATAAAAALLGLECKVFMGEEDIRRQAPNVFRMKLMGAEVIPVASGTATLKDA
MNEAMRHWATYIRDTFYVIGSVAGPHPYPLMVRHFQSVIGQETRRQILRAEGRLPDKIVA
CVGGGSNAAGMFHAFLEDESVKLIGVEAGGLGIESGKHGATICAGEPGVFHGSRSYVLQD
ENGQIKEAHSISAGLDYPGVGPEHSFLASKGRVKYVPINDDEALEAFSELCKTEGIIPAL
ESSHALAQAKKEMALMQSGEICVVNLSGRGDKDMPIIEKVLAGD
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcggtgcactgcgcaacctgcgcttgatacagttcccgacataaagggatattatgga
caattcggagggcgctttgtccccgagattctcattactccacttctcgagctggaagaa
gtctttctcgacatagttcattcgcctgatttctcacaaagactgattcgattactggag
acctatgcgggcagggaaacgcctttattccaggcctcacgtttggccgcgaagtgggga
aaagcaaaactctacttgaaacgcgaagatctcctgcataccggggctcataaaatcaac
aatacgctcggtcaggcgcttctcgcacggcacatggggaagcgcaacgtgatagctgaa
accggcgcaggccagcatggtgtcgcaactgccgctgctgctgctctccttggactggaa
tgtaaggtgttcatgggggaggaggatattcgcaggcaggcgccgaatgttttccgtatg
aagctcatgggcgctgaggtgattccggtcgcctcaggaacggcaacactcaaggatgcc
atgaatgaagcaatgcggcactgggccacgtatatcagagatacgttttacgtcatcggg
tccgtagccgggccgcatccatatccgctcatggtgagacattttcaatccgttataggc
caggaaacccggcggcaaatactcagggctgaaggcaggctgcccgacaaaatcgttgca
tgcgtcggtggaggaagcaacgcggcgggaatgttccatgcattcctggaggatgagagc
gtaaaactgatcggagtggaagctggcggtctgggaatagaatccggcaaacacggagct
acaatctgcgcgggcgagccaggggtgtttcacggttcgcgatcttacgtgctccaggac
gaaaacggtcagatcaaggaagctcattccatttcggcagggctggactatccgggcgtg
gggccggagcactcgttcctcgcatccaagggacgagtcaaatacgttcctatcaatgat
gacgaagccctggaagcattcagtgagctctgcaagacagaagggatcattcccgcgctg
gaatcgtcccatgctttggcccaggcaaagaaagaaatggcgctgatgcaaagtggcgag
atctgtgtcgtgaatttatccggcaggggtgacaaggacatgcccataatcgaaaaagtg
ctggcaggtgactga

DBGET integrated database retrieval system