KEGG   Desulfomonile tiedjei: Desti_4116Help
Entry
Desti_4116        CDS       T02147                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00260  Glycine, serine and threonine metabolism
dti00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dti01100  Metabolic pathways
dti01110  Biosynthesis of secondary metabolites
dti01130  Biosynthesis of antibiotics
dti01230  Biosynthesis of amino acids
Module
dti_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desti_4116
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desti_4116
Enzymes [BR:dti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desti_4116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFM26754
UniProt: I4CB13
Position
4787861..4789075
Genome map
AA seq 404 aa AA seqDB search
MRCTAQPALDTVPDIKGYYGQFGGRFVPEILITPLLELEEVFLDIVHSPDFSQRLIRLLE
TYAGRETPLFQASRLAAKWGKAKLYLKREDLLHTGAHKINNTLGQALLARHMGKRNVIAE
TGAGQHGVATAAAAALLGLECKVFMGEEDIRRQAPNVFRMKLMGAEVIPVASGTATLKDA
MNEAMRHWATYIRDTFYVIGSVAGPHPYPLMVRHFQSVIGQETRRQILRAEGRLPDKIVA
CVGGGSNAAGMFHAFLEDESVKLIGVEAGGLGIESGKHGATICAGEPGVFHGSRSYVLQD
ENGQIKEAHSISAGLDYPGVGPEHSFLASKGRVKYVPINDDEALEAFSELCKTEGIIPAL
ESSHALAQAKKEMALMQSGEICVVNLSGRGDKDMPIIEKVLAGD
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcggtgcactgcgcaacctgcgcttgatacagttcccgacataaagggatattatgga
caattcggagggcgctttgtccccgagattctcattactccacttctcgagctggaagaa
gtctttctcgacatagttcattcgcctgatttctcacaaagactgattcgattactggag
acctatgcgggcagggaaacgcctttattccaggcctcacgtttggccgcgaagtgggga
aaagcaaaactctacttgaaacgcgaagatctcctgcataccggggctcataaaatcaac
aatacgctcggtcaggcgcttctcgcacggcacatggggaagcgcaacgtgatagctgaa
accggcgcaggccagcatggtgtcgcaactgccgctgctgctgctctccttggactggaa
tgtaaggtgttcatgggggaggaggatattcgcaggcaggcgccgaatgttttccgtatg
aagctcatgggcgctgaggtgattccggtcgcctcaggaacggcaacactcaaggatgcc
atgaatgaagcaatgcggcactgggccacgtatatcagagatacgttttacgtcatcggg
tccgtagccgggccgcatccatatccgctcatggtgagacattttcaatccgttataggc
caggaaacccggcggcaaatactcagggctgaaggcaggctgcccgacaaaatcgttgca
tgcgtcggtggaggaagcaacgcggcgggaatgttccatgcattcctggaggatgagagc
gtaaaactgatcggagtggaagctggcggtctgggaatagaatccggcaaacacggagct
acaatctgcgcgggcgagccaggggtgtttcacggttcgcgatcttacgtgctccaggac
gaaaacggtcagatcaaggaagctcattccatttcggcagggctggactatccgggcgtg
gggccggagcactcgttcctcgcatccaagggacgagtcaaatacgttcctatcaatgat
gacgaagccctggaagcattcagtgagctctgcaagacagaagggatcattcccgcgctg
gaatcgtcccatgctttggcccaggcaaagaaagaaatggcgctgatgcaaagtggcgag
atctgtgtcgtgaatttatccggcaggggtgacaaggacatgcccataatcgaaaaagtg
ctggcaggtgactga

DBGET integrated database retrieval system