KEGG   Desulfomonile tiedjei: Desti_4117Help
Entry
Desti_4117        CDS       T02147                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dti  Desulfomonile tiedjei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desti_4117
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desti_4117
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desti_4117
Enzymes [BR:dti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desti_4117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4789077..4789856
Genome map
AA seq 259 aa AA seqDB search
MKRIAETFENLRNQDKTAFIPFSVAGFPDVNASLEIFLKLAEAGNVVEFGFPFSDPTADG
PVIQQAAHTAIQNGMNMDAAFEMIRKIRTRTDTPIIFFSYFNPIHKYGPARFAATAAECG
VDGVLVVDLPMEESHFLKPQTDAAGIAWINLATPTTPEARIQDMNHNGSGFLYYVSRTGV
TGANGGLPTDLAQQCSKLRVLSELPVAVGFGIATPEDAANLRGHADGVVVGSAIVSHVAT
KGIGTELDSWLKTMTDSLA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaattgcagaaacgttcgaaaatctccgcaatcaggataagaccgcattcatc
ccgttttccgttgcaggctttccggatgtgaatgcgtcgctggaaatattcctgaaattg
gccgaagcgggcaatgtcgtggagttcggatttcccttctcagacccgacagcagatgga
cctgtgatccagcaggccgcacacaccgcaatccaaaacgggatgaatatggatgcggct
tttgaaatgatccgaaagatccgaactagaacggacaccccgattatcttcttcagctat
ttcaatcccatacacaagtacggtcctgcacggtttgcagcaactgcagcagagtgcggc
gttgacggtgtcctcgtggtggaccttcctatggaagaatctcatttcctcaagcctcaa
accgatgccgcaggaattgcctggatcaacctggccacaccgacgactccggaagctcgc
attcaagatatgaaccataacggttcggggtttctgtattacgtctccaggaccggagtg
accggtgcaaatggcgggcttcccacagatcttgcacagcaatgcagcaaactccgcgta
ttgtctgaactccccgtggcagtcgggttcggcatagcaactcctgaagatgcagcaaac
ctgcggggacacgcggacggcgtagtcgtcggaagcgctatcgtttcccacgttgcaacc
aagggaatcggcacagaattggattcgtggctgaaaacgatgacggatagtttagcgtga

DBGET integrated database retrieval system