KEGG   Desulfomonile tiedjei: Desti_4651Help
Entry
Desti_4651        CDS       T02147                                 

Definition
dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase like protein
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
dti  Desulfomonile tiedjei
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Desti_4651
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Desti_4651
Enzymes [BR:dti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Desti_4651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5375634..5376503
Genome map
AA seq 289 aa AA seqDB search
MKIDLSQPTRGGITEPKIKSEEILILLDDDFNSSNVCIVTGAASGIGRATAVAAAANNLT
TVGLDLNEEEGKRTQQMAKEKGGRMVFLKTDLTRDDEIEGAVQEAAKLGYIKFLVNIAGF
QHIDSIENFPMEKYDLMQRIMLRAPFFLSKLCIPHMKKGPSGTGVIGNMASIHAHICTVN
KPVYNITKFGLRALSQSISAEGNGKIRSFTVSTGFVKTPLVLNQIPSQAEQRSISQEEVV
HDIMMGKSRVKDMMAPIETANLFMFGFSRYARYLVGGDLLFDGGIVLTY
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgatctttcacagccgaccaggggcggaattaccgagccaaaaataaagtca
gaagagatcctgatcttactcgatgacgatttcaacagctcgaacgtgtgtatcgttacc
ggtgcagccagtggcatcggaagggcaactgcagttgcagccgcggcaaacaacctgacc
acggtggggctggacctgaacgaggaagaaggaaaacggactcagcagatggccaaggag
aaaggcggccgcatggtcttcctcaagaccgatctcacccgtgacgatgaaattgaagga
gccgtccaggaagcagccaagcttggctatatcaagtttctcgtcaatattgctggcttt
caacatatcgattcgattgaaaatttccctatggaaaaatacgatctcatgcaacgaatt
atgctaagggcgcctttcttcctgtcaaagctctgcatccctcacatgaagaaaggccct
tccggaaccggcgtaatcggaaacatggcaagcattcatgcacatatctgcactgtgaac
aagccggtgtacaacatcaccaaatttggtctcagggcattatcgcaatcaatctctgct
gagggaaacggcaagatcagatcgttcacggtaagtaccggattcgtaaagacgccttta
gtactcaaccagattccgtctcaggccgagcaacggagcatctcacaggaagaggtcgtg
cacgacatcatgatggggaaatcgagagtaaaagacatgatggctcccattgaaacagcg
aacctctttatgttcggtttttctcgatacgcacggtatctcgtggggggggatttactt
tttgatggcggcatagtgctcacttactag

  All links  
No link information was found.   
DBGET integrated database retrieval system