KEGG   Desulfomonile tiedjei: Desti_4704Help
Entry
Desti_4704        CDS       T02147                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
dti  Desulfomonile tiedjei
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Desti_4704
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Desti_4704
Enzymes [BR:dti01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Desti_4704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5430438..5431994
Genome map
AA seq 518 aa AA seqDB search
MKLSEIAHALNNAQIVGDPSVEITAVHHDSRKSLPGSLFVAMRGEVVDGHNYIGAALKAG
ASAVMAERRSIQSQEVPEILVPDTRAALGIAAAEVYGRPTEKLSLTGITGTNGKTTLTFL
LESIVKAAGGYPGVVGTISHRWGTAEQAAAHTTPEASDLQMLFRDMVRDSVTHAFVEVSS
HGLHRGRLEGCEFDLGVFTNLTQDHLDYHGSLEEYYLAKRILFDRLLPSSSKSKKAAAIN
WEDPYGLRLIRETQGYPIIGYGIGEDSEVRPLNITVDPDGIRGTIVTPRGNVRVESALAG
SFNLMNILAAVAVCECLEIPIAAVQQGLAAVRAVPGRLERVESEQGIIFVDYAHTPNALK
NVLDALRIMKRSRIVTVMGCGGDRDTAKRPLMGAEAAAGSDFVIVTSDNPRSEDPLDIIR
QVEVGVRDSGYKLLPADLNGKTLHPGCYKVIPDRGNAIAWAIDRLSRDDILLVAGKGHET
YQEIKGVRYPFDDREVIRKELRKHASGTGPNGERKGSL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtctgaaattgcacatgctctcaataatgcccagattgtgggagatccctcg
gtagagattaccgcggtacaccatgacagccggaagagtcttccgggctctctgttcgta
gccatgcgcggcgaagttgtcgatgggcacaattatatcggtgcggcactaaaggccggg
gcgtctgcagtaatggcagagcgccggtccatacaatctcaggaagtgccggagatacta
gttccggacacgagggctgctctgggtattgctgcagcggaagtctacggcagacctacg
gagaaactgtcactcaccgggatcacgggtacaaacggaaaaacaacgctgacgtttctc
ctcgaatccattgtcaaagcagcaggcggatatcccggtgttgtgggcactatttcgcat
cgttggggaacggctgaacaggccgcagcacataccactccggaagcgtcggatcttcaa
atgctttttcgcgatatggtccgagactcggtcacccatgctttcgtggaagtgtcctca
cacgggctccatcgcggcagactcgagggctgcgagttcgacctgggagtcttcacgaat
ctgactcaggaccatttggattatcacggcagcctggaagagtactatctggccaaacgc
atcctgttcgatcggctcttgccgtccagctccaaatccaaaaaggcggcggcgatcaac
tgggaagatccatacggattgcgattgatccgggaaactcaagggtacccgattatcggt
tacggcattggcgaagattccgaggttcggcctctgaacatcaccgtagatcccgacggt
attcgcggtacgatagtgactcccagaggcaatgtgcgagtggaatccgcactcgcgggt
tcattcaatctcatgaacattcttgctgctgtcgcggtatgcgaatgtctggagataccc
attgctgcagtacaacaaggactggctgcagttcgcgctgtccccggcaggctggagcga
gtggaatcggaacagggaataatattcgtcgattatgctcatacgcccaatgccttgaag
aatgtcctcgatgcgcttcgaatcatgaaacggtcccgtatcgttaccgtgatgggatgc
ggcggcgaccgcgataccgcgaaacggccgctcatgggagccgaagctgctgccggaagc
gatttcgtgattgtcacatccgacaatccgcgttctgaagatccgctcgatatcattcgt
caagtggaagttggagtgcgggattccgggtacaaacttttgcccgcggatctgaatgga
aaaaccctgcaccccggctgctacaaagtgattcccgatcgcgggaatgccatagcatgg
gcgattgaccgcctttcccgagacgatattctcctcgtggcaggaaagggacacgaaacg
taccaggagatcaaaggagttcggtatccttttgatgatagagaagtgatacggaaagaa
ttgagaaaacacgcatccggaacaggtccgaatggagaaaggaaaggctcgttatga

DBGET integrated database retrieval system