KEGG   Desulfomonile tiedjei: Desti_4831Help
Entry
Desti_4831        CDS       T02147                                 

Definition
Mg-chelatase subunit ChlI (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
dti  Desulfomonile tiedjei
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Desti_4831
Enzymes [BR:dti01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Desti_4831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5575245..5576294
Genome map
AA seq 349 aa AA seqDB search
MNTKTIYPFAAIVGQQRMKLGLILNVINPAIGGVLIRGEKGTAKSTAVRALADLLPLIEV
VRECPFQLSPEAAHEVCLECWKHDCRRIRLDGGRPDSDLRKTRVIELPVGATEDRLIGTL
DLEHALKKGEKRIEPGILAEAHRGILYVDEVNLLDDHLVDVLLDSAAMGINTVEREGVSF
THPAQFTLVGTMNPEEGELRPQLLDRFGLCVTIEGIRDSSSRVEIMERRLRFEEDPTGFA
QEWDNESAAVVEKIRNAVDLYSRITVDRSILMEIARYCLDVGVDGHRGDIVTLKAAKALA
AYDNRTDVTVEDVNAAAELALPHRVRRQPLQDVAVDVKVLRDSLSKQHS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaaagacaatctatcctttcgcagccattgtcggtcaacaaagaatgaagctc
gggctcattctcaatgttatcaaccctgcaatcggtggtgtgctcatacgcggcgaaaag
ggcacagccaaatcaacggccgtacgagctttggcagatctgctgccactgatcgaagtt
gttcgggagtgtccttttcagttgtctcctgaagcagctcacgaagtatgcctggaatgt
tggaagcacgattgccgccgcattcgcctggacggcgggcgtcctgattcagatcttcgc
aaaacgagagtgatcgaactccctgtcggagccacagaagacaggcttatcggcactctg
gacctggagcatgcgttaaagaaaggcgaaaaacgtatcgaaccgggaattctggcggaa
gctcatcggggaattctctatgtggacgaggtgaacttactggacgatcacctcgtggat
gtcctgctggattccgcagcaatgggaatcaacacagttgaacgagagggcgtctctttt
acccatccggcacaattcacgctcgtgggcacaatgaatcctgaagaaggggaactccgg
ccgcaactattggaccgcttcggcctgtgcgttaccatcgaaggaattcgcgacagctcg
tcccgcgtggaaatcatggaaaggcgtctcagatttgaggaagatccgacaggattcgca
caagaatgggacaacgaatctgccgctgttgtggaaaaaatccggaatgctgtggatctg
tattcccgaataaccgtcgatcgatccatcctcatggagattgcacgctattgcctggat
gtaggagttgacggtcatcgtggcgacatagtcactttgaaagccgctaaagcactggca
gcgtacgacaaccgtacagacgttaccgtggaagacgtgaatgcggcagcagagctcgct
cttccacaccgggttcgcagacagccgctccaggatgttgctgtcgatgtgaaggtgctg
agagactctctgagcaaacaacattcatga

DBGET integrated database retrieval system