KEGG   Desulfomonile tiedjei: Desti_5034Help
Entry
Desti_5034        CDS       T02147                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dti  Desulfomonile tiedjei
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dti00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Desti_5034
DNA repair and recombination proteins [BR:dti03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Desti_5034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5810317..5810904
Genome map
AA seq 195 aa AA seqDB search
MRPLEDLIEVLKRFPGVGEKTATRYAFYVMHAGDADIQQLIRAIKSVKEKLRLCSRCFHL
TDVDPCQICTDKRRDPTRLCVVETPMDLLAIEKAGQFRGLYHVLHGVLSPLDGIGPGDIR
FSELLDRVRDEGVREVILAFNPTVEGESTSSFIAERIKSMDVSVSRIAYGIPVGGSLEYS
DPLTLSRALDNRKPM
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtgcgacctctcgaagatttgatcgaagttttgaaacgattcccgggggtaggcgagaaa
actgccactcggtatgcgttttacgttatgcatgccggtgacgccgatatccagcaactg
attcgagcgataaaatccgtcaaagaaaagttgcggctctgttcgaggtgctttcatctc
accgatgtggacccgtgtcagatttgcacggataaacgtcgagaccccacgcggctctgt
gtcgtggaaactccaatggatctgcttgcaattgaaaaggcaggtcagttccgtggtttg
taccacgtcttgcacggggttctctcccctctggacgggataggacctggagacatccgt
ttctcggaactcctggatagggtccgagatgaaggagttcgggaagtgatcctcgcattc
aaccccaccgtggaaggcgaatcaacgtcctcgtttatcgctgaacggatcaagagcatg
gacgtctcggtttcgcgtattgcgtacggaatacccgtgggcggttcgctggaatactcc
gatccgttgactttgtcacgagctctcgataacagaaaacccatgtaa

DBGET integrated database retrieval system