KEGG   Desulfomonile tiedjei: Desti_5460Help
Entry
Desti_5460        CDS       T02147                                 

Definition
Mg-chelatase subunit ChlI (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
dti  Desulfomonile tiedjei
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Desti_5460
Enzymes [BR:dti01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Desti_5460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6285309..6287177)
Genome map
AA seq 622 aa AA seqDB search
MGFSDFVGHEDARLALTLNAIEPLCGGVLFAGEKGSGKTTLARLFKRLLPERTPFVTLPL
NVTEDALVGTIDIETTIRTGKKVIQRGLLSRAHGGILFVDDVNLLSPESVSLVLEVSGRG
ANFVEREGLSERHDADFMLIATMDPQEAFLSPHFIDRFGMCVLWESLWDKKDRTSVVKRA
VANRFNLDGPNTLADEALRNRIQNSRRFLKQVTVSEGVWEYIAQRCLENAVSGHRAELFL
YYATKAYAAYRGDKKANTSHVDAVAPLVLVHRRRNVLPPEEETTHEHNHEDKENEQQPES
NDTQSEQQQGCDEMPQTDNAESSAPDDNDEFTPDTSPRETALREEVFDTGETFRTKRLSF
RKDRLKRMSAGRRTKTRSKDKGGRYVRSILRAEDDVAIDATIRAAAPYQSLRNRDNMLVI
HDRDLRYKQREKKTGHLVIFAVDGSGSMGAQKRMVETKGAIQSLLMDCYQKRDKVAMLVF
RKEKAEIVLPPTSSVEHASRRLKEIPTGGKTPLGSGLMEAYNLIKRYAKKAPETRFLLVI
ITDGRANHSLSGLPVQEEVMRISQLLSEIPGTDYIVVDTEDKSKFMKADFAVPLADRLNA
SYYTIDDLKADYLVDLVKQEKG
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgggattcagcgattttgtcggtcatgaagacgctcggcttgcgcttaccctcaatgcc
attgagccgctctgtggcggtgttcttttcgcaggagaaaaggggagcggaaagacaaca
ctcgctcgtttgttcaagagacttcttccggaacgaacgcctttcgttacgctccccctc
aatgttactgaagacgccctcgttggcaccatagatattgaaacgaccatacgcacaggg
aaaaaggtgatccaacggggtctcctcagtagagcacatggcggtatccttttcgtcgat
gatgtcaaccttctttcgcccgaatcggtctcgctagtcctagaggttagtggcagagga
gctaatttcgtggagagggaaggattgtctgagcgacatgacgcagacttcatgctcatt
gccactatggacccgcaggaggcatttctctctccacatttcattgatcggttcggcatg
tgcgtgctgtgggaaagtctttgggataagaaagaccgaacctcggtcgtcaagagggcc
gtggcaaatcggttcaatcttgatggcccaaatactctggcggacgaggccttgcgaaac
aggattcagaactccagaagatttctcaaacaggttaccgtttccgaaggtgtgtgggag
tacatcgcacaaaggtgtctcgaaaatgccgtttccgggcaccgtgcggaactctttctg
tactacgcgaccaaggcctatgcagcgtaccgcggggacaaaaaagctaatacaagccac
gtggatgccgttgcaccgttggttctagtgcatcgtagaagaaacgtattgccgcccgaa
gaagagaccactcacgagcataaccatgaggacaaagagaacgaacagcagcccgaatcc
aacgatacgcaaagcgagcaacagcaaggctgtgatgagatgccgcagacagataatgct
gagtcctctgcccctgatgacaatgatgaattcacccccgatacttctccacgtgagacc
gctctgagggaagaagtgttcgatactggagaaaccttccgtacaaaacgtctttctttc
agaaaagacagattgaaacgtatgtccgcaggacgcaggacgaagacacgttccaaggac
aaaggtggaagatatgtacgcagcatcctcagagcagaagacgatgtcgctatagatgca
actatacgtgcagcggcaccctatcaaagcctccggaaccgggataatatgcttgttatc
cacgatcgcgatctccggtacaagcagcgagagaagaagactggccatttagtcattttt
gccgttgacggctccggttcgatgggtgcgcagaagaggatggtcgagaccaaaggcgca
atccagtccttactcatggattgctatcagaaacgagacaaagtggccatgctcgtcttt
aggaaggaaaaggccgagatcgtgctgccgccgacttcaagtgtcgagcatgcctcgcga
agactcaaagaaatacccactggaggaaagacgcctttgggttcgggcctgatggaggcc
tataacctgatcaagaggtacgcgaagaaagctccggaaactcgcttcttgcttgtgatc
atcactgacggaagggcgaaccattcgctatccggtcttccggttcaagaagaagtcatg
agaatttcgcaactcctcagcgaaatccccggaacggattacatcgtcgtggatacagag
gacaagagcaagttcatgaaggctgatttcgctgttccattggccgaccggcttaacgcg
agttactatacgatagatgaccttaaggccgactatctggttgatttagtgaagcaagaa
aaagggtag

DBGET integrated database retrieval system