KEGG   Desulfomonile tiedjei: Desti_5624Help
Entry
Desti_5624        CDS       T02147                                 

Definition
2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
dti  Desulfomonile tiedjei
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:dti01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dti00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dti00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dti00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dti00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dti00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:dti00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:dti00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6479834..6480130
Genome map
AA seq 98 aa AA seqDB search
MTKPMDEMTWQEVEPGGVISEPGCASCYHTGTWRSEKPVYNPDKCIRCQRCFIMCPDASI
KPDFESNCMVWDYDYCKGCGICAYECPVGAIEMVQEDE
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
gtgactaaaccaatggatgaaatgacctggcaagaagtggaaccgggaggagttatttct
gaaccgggctgcgcttcatgctaccacacgggaacatggcgttcggaaaaacccgtatat
aatccggataagtgtatcagatgtcaacgttgcttcatcatgtgcccggatgcgtcaatt
aagccggatttcgaaagcaactgcatggtctgggattacgactactgcaaaggctgcggt
atttgtgcctatgagtgtcccgttggggccatagaaatggtgcaggaggacgaataa

DBGET integrated database retrieval system