KEGG   Desulfomonile tiedjei: Desti_5626Help
Entry
Desti_5626        CDS       T02147                                 

Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, beta subunit
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
dti  Desulfomonile tiedjei
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desti_5626
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desti_5626
   00020 Citrate cycle (TCA cycle)
    Desti_5626
   00620 Pyruvate metabolism
    Desti_5626
   00640 Propanoate metabolism
    Desti_5626
   00650 Butanoate metabolism
    Desti_5626
  Energy metabolism
   00680 Methane metabolism
    Desti_5626
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Desti_5626
Enzymes [BR:dti01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Desti_5626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
6481363..6482298
Genome map
AA seq 311 aa AA seqDB search
MAETSKTRLLKPLKNFPSEEYINAGHRACQGCAEVLAVRHVLKAIGPDMILAMATGCMEI
ISSPYPLTSWNIPWIHIAFENAAAVASGVESGLKALRRKGRIPDKEVTVVAMGGDGGTSD
IGFQALSGMMERGHKVIYVCVDNEAYMNTGVQRSSSTPFGATTTTSPSGRVTPSGQTTWK
KDMTAIAAAHGIPYTATACPTFYQDLMNKVQKARAANGPAYLHVLSVCPTGWRIPPQKAI
EYGKLAVDSGVFPLYEVENGIWKLSRKPKELIPVSDYFKGQGRYRHLDETLMKYIQERVT
EKWERLVKLCE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaacaagtaaaacaagactcttgaagccgctgaaaaacttcccttcggaagaa
tacataaatgccggacaccgggcatgccagggatgcgccgaggttctggctgtccgccat
gtgctgaaagccatcggaccggacatgattctcgctatggcgaccgggtgcatggagatc
atctcatcgccttatccgctcacgtcctggaatattccctggatacacattgcattcgag
aatgccgcagcagtagcttccggggtagaatcgggactaaaagcgcttcggcggaaaggt
cgtattcctgataaggaggttacggttgtcgccatgggcggtgacggcggaaccagcgat
atcggatttcaggcgctttccgggatgatggagcgaggtcataaggtcatttacgtttgc
gtggacaacgaagcctatatgaacaccggtgtgcagaggtcgtcctccactcctttcggt
gctaccaccacaacatcgccttcaggaagggtaacaccttcgggccagaccacgtggaaa
aaggacatgaccgccatagctgcagctcacggtatcccgtacacggcaacagcatgccct
acattttatcaggatctcatgaacaaggtgcaaaaagcccgggcagcgaacggtcctgcg
tacttgcatgtattgtcggtttgtcctaccggatggaggattccccctcaaaaggctatc
gagtacggcaagctggcggtggattccggagtgtttcccctgtacgaagtggaaaacgga
atctggaaactgagccgcaaaccgaaagagcttatccctgtaagcgattacttcaaagga
caagggcggtaccgtcatttggatgagactttgatgaagtacatccaagaacgagtcaca
gaaaaatgggagcgccttgtcaagctgtgtgagtag

DBGET integrated database retrieval system