KEGG   Desulfobacula toluolica: TOL2_C00240Help
Entry
TOL2_C00240       CDS       T02268                                 

Gene name
pncA
Definition
Nicotinamidase (Nicotin deamidase) (NAMase) PncA (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
dto  Desulfobacula toluolica
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    TOL2_C00240 (pncA)
Enzymes [BR:dto01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     TOL2_C00240 (pncA)
    3.5.1.-  
     TOL2_C00240 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
37975..38685
Genome map
AA seq 236 aa AA seqDB search
MINKMIAGAGMKIFKGGIQMEVSMDKDHTGVIVVDVQGDFTHFKKGSLAVQNTDQDYIDA
VLSTTKQLKSKGYKIFATQDFHPENHISFYTSHKNKSAYETIDVEGRTQVLWPPHCVRGA
ENTEILIDKNLFTATIQKGMNPKYDSYSGFFDDVGMATGLDDLLKSHGITTLLIYGLATD
YCVKATAMDALKSGFKVILVEELCKGVALDTTASALEEMRSAGIKIISRVSDLPSF
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgataaataaaatgattgccggtgcaggcatgaaaatttttaagggaggcatacagatg
gaggtttcaatggataaagatcacacaggtgtgattgttgtggatgtacaaggagatttc
acccatttcaaaaaagggtctcttgcggttcaaaatacggatcaggactatattgacgca
gtgctgtccacaacaaaacaactgaaatccaagggatataaaatttttgccacccaggat
tttcatcctgaaaatcatatctctttttacaccagtcataaaaacaaatctgcttacgaa
accattgatgtagaaggccgaacccaggttctctggccacctcattgtgtccggggggct
gaaaataccgagattttaatagataaaaatttgtttaccgccacaattcaaaaaggtatg
aaccccaaatatgattcttattcaggctttttcgatgatgtcggtatggccactgggctg
gatgatttgctcaagtcgcatggtataacaacgcttttgatctacgggcttgctacagat
tattgtgtaaaagcaaccgccatggatgcacttaaatccgggttcaaggtgatcctggtt
gaggaactttgtaaaggagttgcattggacaccactgcatcagcattggaagaaatgaga
tcagcaggtattaaaatcatttccagggtatctgacctgccgtccttttga

DBGET integrated database retrieval system