KEGG   Desulfobacula toluolica: TOL2_C00430Help
Entry
TOL2_C00430       CDS       T02268                                 

Gene name
aor1
Definition
ferredoxin oxidoreductase tungsten-containing aldehyde
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dto  Desulfobacula toluolica
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dto01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dto00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(59484..61379)
Genome map
AA seq 631 aa AA seqDB search
MRIDLTGGKVTVEEISKEHLRKWLGGRGLNSELLYRETEPELDPFSPENRLIFGVGPLTG
TFAPSSGRCTVTSKSPAQDPAGFGDANMGGHWGAELKYAGYDQLVIQGKADSPVYLYINN
GRVEIRDAEHLWGKNIPETDTLIKNELQNHELHIALIGLAGENLVRYACIINDVYRAAGR
CGMGAVMGSKNLKAIALRGTNPVEIARPREFFEICSRARKKMRQDAMVQMLNDQGTLLLT
TPANHDQGWFCWKNFQKGHHPDADLLNGENHRDRFLAHREGCFACSIACGRFSRISKGEY
AGEITGGPEYETVTAMGPRIGLLDPASVIHNNRLVNELGMDSCSCGGAISWAMECYEKGL
LTKKETNGLTLRWGDQELIDKLVRMIASREGFGDILAEGAHHAAKKLDCGHEYTMSIKGH
TMSQDDPRGLGFAFGIGFATGRRGGDHLQGLACLELTGAFYPGLVEKTLGDKAAEKPLSK
VKKPEMEKYQEDLKAVGDCLTQCSFTHSWSFAVLPEHMAAMLSAATGMDFSPEELLQIGG
RIVHLERAYWNRLLVGRLEDKNPRRFTEEPMPDGPNKGSLFPEAELIPLYYQVRGWDPET
GFPTADVLNEYGLPDIADELEPYRIKYLEYV
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtattgatctgaccggcgggaaggtcacggtggaagagatatcaaaggaacacttg
agaaaatggctcggaggacggggccttaactcggaacttctctaccgtgaaacagaaccg
gaattggatcctttttcacctgaaaaccggcttatcttcggcgtcggtcccctcacggga
acctttgccccctccagtggcagatgcacggtgacctccaaatcgccggcacaggacccc
gccggtttcggagatgccaacatgggtgggcactggggtgcggaactcaaatatgccgga
tacgatcagctggtgattcagggaaaggctgacagtccggtatatctttatatcaacaac
ggccgggttgaaatacgggatgccgaacatctgtggggaaaaaacattcctgaaacagac
acgctcatcaaaaacgagctgcaaaaccatgaactccatattgcccttatcgggctggcc
ggcgaaaacctggttcgttatgcctgcatcattaatgatgtgtaccgggctgcgggcagg
tgtggcatgggagcggtcatgggttccaaaaatctgaaagccattgctcttcgggggacc
aatccggttgagattgcccggccccgggagtttttcgaaatctgctcccgggcccggaaa
aagatgcggcaggatgccatggttcagatgctcaacgaccaggggacactgcttctcacc
acaccggcaaatcatgaccagggttggttttgctggaaaaattttcaaaaagggcatcac
cccgatgctgatctgctgaacggtgagaaccatcgggatcggtttctggctcaccgggaa
gggtgctttgcctgttccatcgcctgcggaaggttcagcaggatctccaagggagaatat
gccggtgagataacaggggggccggagtatgaaaccgttactgccatggggccccgaatc
ggtttgttggacccggcttcggtgattcacaacaacagactggtcaacgaactgggtatg
gactcctgctcctgcgggggagccatttcatgggccatggagtgttacgaaaaagggctg
ctcaccaaaaaggagaccaatgggctgacactcaggtggggtgatcaggagttgatcgac
aagctggtccggatgattgcttcccgggaaggattcggagatattctggctgaaggggcc
caccatgcggccaaaaagctggattgcgggcatgaatataccatgagcattaagggacat
accatgtcccaggacgatccccggggcctgggttttgcctttggcatcggttttgccacc
ggacggcgggggggagatcacctccagggactggcctgcctggaactgaccggggccttc
tatcccggcctggtggagaaaaccctgggagataaggcggctgaaaaacccctttcaaaa
gtgaaaaaaccggaaatggaaaaatatcaggaggatctcaaagcggtgggcgactgcctg
acccagtgcagctttacccacagctggtcttttgccgttcttccggaacatatggcagcc
atgctttccgcagccaccggcatggacttttcaccggaagagctgctgcagatcggaggc
cgcattgtccatctggaaagagcctactggaaccgtctgctggtgggacggctggaggac
aaaaacccccggcgttttaccgaggagcccatgcccgacggccccaacaagggaagcctc
tttcctgaggcggaactcattcccctctactatcaggtccggggctgggaccctgaaacc
ggttttcccaccgctgatgtcctgaacgaatacggtctgccggatattgccgatgagctg
gagccttaccgcatcaaataccttgaatatgtatag

DBGET integrated database retrieval system