KEGG   Desulfobacula toluolica: TOL2_C02300Help
Entry
TOL2_C02300       CDS       T02268                                 

Gene name
padG1
Definition
(GenBank) PadG1: phenylglyoxylate:acceptor oxidoreductase, subunit G
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
dto  Desulfobacula toluolica
Pathway
dto00010  Glycolysis / Gluconeogenesis
dto00020  Citrate cycle (TCA cycle)
dto00620  Pyruvate metabolism
dto00633  Nitrotoluene degradation
dto00640  Propanoate metabolism
dto00650  Butanoate metabolism
dto00680  Methane metabolism
dto01100  Metabolic pathways
dto01120  Microbial metabolism in diverse environments
dto01130  Biosynthesis of antibiotics
dto01200  Carbon metabolism
Module
dto_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TOL2_C02300 (padG1)
   00020 Citrate cycle (TCA cycle)
    TOL2_C02300 (padG1)
   00620 Pyruvate metabolism
    TOL2_C02300 (padG1)
   00640 Propanoate metabolism
    TOL2_C02300 (padG1)
   00650 Butanoate metabolism
    TOL2_C02300 (padG1)
  Energy metabolism
   00680 Methane metabolism
    TOL2_C02300 (padG1)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TOL2_C02300 (padG1)
Enzymes [BR:dto01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TOL2_C02300 (padG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: CCK78400
UniProt: K0NCJ4
Position
279267..280478
Genome map
AA seq 403 aa AA seqDB search
MEKSQIKVITGNAAAAIAAKLARPDVVAAYPITPQTEIIEQISKFHANEEMDCELITVEG
ENSAMNAVMAASLAGGRVFTATSSWGLAFMYDAVLATAGARAPVVMVNVNRETPGIIAVS
SGQQDMISTRDCGWIFLIAEDCQEVLDMVLQAYRLAEDYDIQVPVMVHYDGFYLSYLSEG
VDVPFQEDVDKFLAVLKDQPERTKLTPGEKLGCGSHGILGGYLELRHKHVSAMERSKEKF
KQIDKEFEDIFGRSYGGLIEEYRMDDADVVLVGSGSMCGTIKTVIDTKRDAGVKVGLLKM
RMYRPFPSEAMVKALKGKKAIGVVDRSLCFGFKGGPIYTELKAFETKLNGSKMISFIDGI
ANTDITTANVGQMIDTTCDLAAGKDVREVTWVSYPEAQEDGGL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatcacagattaaggttataacaggaaatgccgcagccgccattgctgcgaaa
cttgcccgtccggacgtggtggcagcatacccgattacaccccagacagaaattatcgag
cagatttccaaatttcatgcaaacgaagaaatggattgtgaactgattaccgttgagggc
gaaaactccgccatgaacgctgttatggccgcctcccttgccggcgggcgggtatttacg
gctacgtcttcatgggggcttgcattcatgtatgatgctgttctggcaacagccggagca
agggctcccgtggtcatggtcaatgtaaaccgtgaaacacccggtattattgccgtatct
tcaggccagcaggacatgatctccacaagggattgcggatggattttcctgattgccgag
gattgtcaggaagttcttgacatggttctccaggcctatcgcctggctgaagattatgac
atccaggtgccggttatggttcattatgacgggttttacctgtcgtatctgtctgaaggt
gtggatgtgccttttcaggaagatgtggataaatttttagctgttttaaaagatcagccg
gaaagaacaaaacttactcccggagaaaaactgggctgcggttctcatggaatccttggc
ggatatcttgagcttcggcacaaacatgtgtctgcaatggagaggtccaaagagaaattc
aagcagattgataaggagtttgaagatattttcggtcgcagctacggtggccttattgaa
gaatatcgaatggatgatgcagatgtggttctggtgggttcaggttcaatgtgcggcaca
attaaaaccgttattgatacgaaaagagatgcaggtgtcaaagtcggtcttttgaagatg
agaatgtacaggcccttcccaagcgaagcaatggttaaagcgctcaaaggcaaaaaagcc
attggcgttgtggacagaagcctttgtttcggattcaagggcggtcccatatatactgaa
ctcaaagcttttgaaacaaagcttaacggttcaaaaatgatcagttttattgatggtatt
gccaacacggatatcacaaccgccaatgtcgggcaaatgattgatacaacttgtgatctt
gctgcgggcaaggatgttcgtgaagtcacatgggtttcatatcctgaagcccaggaagat
ggagggctttaa

DBGET integrated database retrieval system