KEGG   Desulfobacula toluolica: TOL2_C02300Help
Entry
TOL2_C02300       CDS       T02268                                 

Gene name
padG1
Definition
(GenBank) PadG1: phenylglyoxylate:acceptor oxidoreductase, subunit G (EC:1.2.1.58)
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
dto  Desulfobacula toluolica
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TOL2_C02300 (padG1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TOL2_C02300 (padG1)
   00020 Citrate cycle (TCA cycle)
    TOL2_C02300 (padG1)
   00620 Pyruvate metabolism
    TOL2_C02300 (padG1)
   00640 Propanoate metabolism
    TOL2_C02300 (padG1)
   00650 Butanoate metabolism
    TOL2_C02300 (padG1)
  Energy metabolism
   00680 Methane metabolism
    TOL2_C02300 (padG1)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TOL2_C02300 (padG1)
Enzymes [BR:dto01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TOL2_C02300 (padG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
279267..280478
Genome map
AA seq 403 aa AA seqDB search
MEKSQIKVITGNAAAAIAAKLARPDVVAAYPITPQTEIIEQISKFHANEEMDCELITVEG
ENSAMNAVMAASLAGGRVFTATSSWGLAFMYDAVLATAGARAPVVMVNVNRETPGIIAVS
SGQQDMISTRDCGWIFLIAEDCQEVLDMVLQAYRLAEDYDIQVPVMVHYDGFYLSYLSEG
VDVPFQEDVDKFLAVLKDQPERTKLTPGEKLGCGSHGILGGYLELRHKHVSAMERSKEKF
KQIDKEFEDIFGRSYGGLIEEYRMDDADVVLVGSGSMCGTIKTVIDTKRDAGVKVGLLKM
RMYRPFPSEAMVKALKGKKAIGVVDRSLCFGFKGGPIYTELKAFETKLNGSKMISFIDGI
ANTDITTANVGQMIDTTCDLAAGKDVREVTWVSYPEAQEDGGL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatcacagattaaggttataacaggaaatgccgcagccgccattgctgcgaaa
cttgcccgtccggacgtggtggcagcatacccgattacaccccagacagaaattatcgag
cagatttccaaatttcatgcaaacgaagaaatggattgtgaactgattaccgttgagggc
gaaaactccgccatgaacgctgttatggccgcctcccttgccggcgggcgggtatttacg
gctacgtcttcatgggggcttgcattcatgtatgatgctgttctggcaacagccggagca
agggctcccgtggtcatggtcaatgtaaaccgtgaaacacccggtattattgccgtatct
tcaggccagcaggacatgatctccacaagggattgcggatggattttcctgattgccgag
gattgtcaggaagttcttgacatggttctccaggcctatcgcctggctgaagattatgac
atccaggtgccggttatggttcattatgacgggttttacctgtcgtatctgtctgaaggt
gtggatgtgccttttcaggaagatgtggataaatttttagctgttttaaaagatcagccg
gaaagaacaaaacttactcccggagaaaaactgggctgcggttctcatggaatccttggc
ggatatcttgagcttcggcacaaacatgtgtctgcaatggagaggtccaaagagaaattc
aagcagattgataaggagtttgaagatattttcggtcgcagctacggtggccttattgaa
gaatatcgaatggatgatgcagatgtggttctggtgggttcaggttcaatgtgcggcaca
attaaaaccgttattgatacgaaaagagatgcaggtgtcaaagtcggtcttttgaagatg
agaatgtacaggcccttcccaagcgaagcaatggttaaagcgctcaaaggcaaaaaagcc
attggcgttgtggacagaagcctttgtttcggattcaagggcggtcccatatatactgaa
ctcaaagcttttgaaacaaagcttaacggttcaaaaatgatcagttttattgatggtatt
gccaacacggatatcacaaccgccaatgtcgggcaaatgattgatacaacttgtgatctt
gctgcgggcaaggatgttcgtgaagtcacatgggtttcatatcctgaagcccaggaagat
ggagggctttaa

DBGET integrated database retrieval system