KEGG   Desulfobacula toluolica: TOL2_C03070Help
Entry
TOL2_C03070       CDS       T02268                                 

Gene name
pgm
Definition
(GenBank) Pgm: phosphoglucomutase (glucose phosphomutase)
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dto  Desulfobacula toluolica
Pathway
dto00010  Glycolysis / Gluconeogenesis
dto00030  Pentose phosphate pathway
dto00051  Fructose and mannose metabolism
dto00052  Galactose metabolism
dto00230  Purine metabolism
dto00500  Starch and sucrose metabolism
dto00520  Amino sugar and nucleotide sugar metabolism
dto00521  Streptomycin biosynthesis
dto01100  Metabolic pathways
dto01110  Biosynthesis of secondary metabolites
dto01120  Microbial metabolism in diverse environments
dto01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TOL2_C03070 (pgm)
   00030 Pentose phosphate pathway
    TOL2_C03070 (pgm)
   00051 Fructose and mannose metabolism
    TOL2_C03070 (pgm)
   00052 Galactose metabolism
    TOL2_C03070 (pgm)
   00500 Starch and sucrose metabolism
    TOL2_C03070 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    TOL2_C03070 (pgm)
  Nucleotide metabolism
   00230 Purine metabolism
    TOL2_C03070 (pgm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TOL2_C03070 (pgm)
Enzymes [BR:dto01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     TOL2_C03070 (pgm)
    5.4.2.8  phosphomannomutase
     TOL2_C03070 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: CCK78477
UniProt: K0NHM6
Position
377870..379225
Genome map
AA seq 451 aa AA seqDB search
MNPGIFREYDIRGVAGKDILEDDVISIGKAYGTLLKNQNKKIVSVGRDCRQTSEQFSNLF
IRGILSTGCDVIDIGTCPTPVLYFSIQHLNLDGGAMVTASHNPPEYNGFKLMNGLDSIHS
QGLQDIRIAIEKNAFVQGDGKVTSKDVITPYKDYILNNIHIKHPIKIGIDAGNGTGGVTA
LPVLEKLGCEVHHIYCDMDGTFPNHEADPTQKKNLTDLIRLVKEKNLDLGVGYDGDADRI
GVVDKNGEVIYGDQLMVIYAREILERDPGATFISEVKCSMVMYDDIRKHGGKAIMWRTGH
SLIKKKMKEENAALAGEMSGHMFFKDRYLGFDDALYATCRLLEIMADTGKGVDELIQDLP
KTFTTPELRVECPDEIKFAVVDKIVAYFKARQKVIDIDGLRAVYDDGWGLVRASNTQPAL
VLRFEALSEKRRDEIRHEIESVLKTIIEEIK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgggaatcttcagggaatatgacataagaggtgttgcaggcaaagatatttta
gaagacgatgtgatcagtatcggcaaggcctatggcacgcttttaaaaaatcagaacaaa
aaaatagtttccgttggaagagattgcagacagacctctgaacaattcagcaaccttttt
atccgtggaatcctttccacgggctgcgatgttattgacatcggaacttgtcctacacct
gtgctgtatttttccatacagcatttaaatcttgacggcggggccatggtgactgcaagc
cataatcccccagaatacaacgggtttaaactgatgaacggtcttgattccattcacagt
cagggactgcaggacattcgtattgccattgaaaaaaacgcctttgtccaaggcgatggc
aaggtaacctcaaaagacgtcatcacgccttataaagattatattttaaataatattcat
atcaaacaccccatcaaaatcggtattgatgccggcaatggaacaggtggcgtcacggct
cttcctgtcctggaaaaactgggatgtgaggtacaccacatatattgcgatatggacgga
acatttcccaaccatgaagcagaccccactcagaaaaaaaatctgactgatttgatacgg
ctggtaaaagaaaaaaatcttgacctgggggttggatatgatggagatgccgacagaata
ggcgttgtggacaaaaatggtgaagtgatttatggtgaccagctcatggttatctatgcc
agggaaattcttgagcgagatccgggtgcgacttttatttcggaagtcaaatgttccatg
gtcatgtatgatgatattcgcaaacatggcggcaaggccatcatgtggcgaaccggccat
tcgttgatcaagaaaaaaatgaaagaggaaaatgctgcgctggccggtgaaatgagcggc
catatgtttttcaaggaccggtatctgggctttgacgatgccctctatgccacctgccgc
ctgctggaaattatggcagatacaggcaaaggggttgacgaactgatccaggatcttccc
aaaaccttcacaacaccagaacttcgtgtggagtgcccggatgagatcaaatttgccgtt
gtggataagatcgttgcctatttcaaggcccggcaaaaagtgattgacattgacgggcta
agggccgtttatgatgacggctggggacttgtcagagcatcaaacacccagcctgccctg
gttcttcgattcgaagccttgagcgaaaaaagacgcgatgaaataaggcatgagatagaa
tccgtattaaaaaccattatagaggagataaaatag

DBGET integrated database retrieval system