KEGG   Desulfobacula toluolica: TOL2_C03360Help
Entry
TOL2_C03360       CDS       T02268                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta TrpB (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dto  Desulfobacula toluolica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TOL2_C03360 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TOL2_C03360 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TOL2_C03360 (trpB)
Enzymes [BR:dto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TOL2_C03360 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
415308..416681
Genome map
AA seq 457 aa AA seqDB search
MQKKIFLNEDEIPRQWYNIAADLPGTINPPLGPDGKPISPEMLAPVFPMNLIEQEVSTER
WIDIPDGILDMLCRWRPSPLHRAIYLEKALKTPAKIFYKDESVSPAGSHKPNTAVAQAWY
NKEFGIKRLTTETGAGQWGSALSYACALLGLECKVFMVKVSFEQKPFRKVLMQTWGGNCV
ASPSNETIVGREILKQTPDTPGSLGIAISEAIEQAVGDESGQTRYALGSVLNHVMLHQTI
IGLEAKKQLAKAGIKKVDTVIGCAGGGSNFAGLAFPFTHDKINGADIEIIPVEPASCPTL
TATPFSYDHGDVAQMTPMLPMHSLGHKYIPAPIHAGGLRYHGMAPLVSHAVEAGLMTPMA
IQQLECYEAAMTFARTEGLLVAPETSHAIAATIRKALEAKETGEEKTIIFNLSGHGLMDL
NGYAKYMAGDLHNISMSEKEIEESRKISMGGNPVPKI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaaaaatatttttaaatgaagatgaaattccccgtcaatggtataacatagcc
gcagaccttcccggaacaattaatccgcctctgggtccggacggcaagcccatcagcccg
gagatgctggccccggtttttcctatgaaccttattgagcaggaagtcagcacggaacga
tggattgatatcccggacggtattctggatatgctgtgcagatggaggccatctccgctt
caccgggcgatttatcttgaaaaagctctgaaaacccctgcaaagatattttacaaagat
gaaagtgtttcccctgccggcagtcacaaaccaaataccgcagtggcccaggcctggtat
aataaagagttcggaatcaaacgcctgacaactgaaaccggtgcaggccagtggggttcg
gcgctttcctatgcctgtgcgctcctgggacttgaatgcaaggtttttatggtaaaggtc
agctttgagcaaaaaccgtttagaaaagttttaatgcagacctggggcggcaattgtgtc
gccagtccgtcaaatgaaacaattgtcggacgtgaaattttaaaacagactccggatacc
ccgggcagcctcggtattgccatcagtgaagccatagaacaggctgtgggcgacgaatca
gggcagacccgttacgccttgggcagtgtcctgaatcatgttatgctgcatcagacaatt
atcggtcttgaagccaaaaaacagcttgcaaaggccggaattaaaaaagtggatacggtc
ataggatgtgcaggtggcggcagtaactttgcaggtctggcatttccgtttacccacgat
aagatcaatggggctgatattgaaatcattcctgtggaaccggcttcctgccccacatta
actgcaacccccttttcctacgatcacggggatgtagcccagatgacacccatgctgccc
atgcattcactgggacacaaatatattccggctcccattcatgccggagggttacgctat
catggcatggcaccactggtatcccatgcggttgaagccggactgatgacccccatggca
attcagcagcttgagtgttacgaagctgccatgacctttgccagaacagaagggcttctg
gtggcacctgaaaccagccatgccattgcagccactattagaaaggcccttgaagccaaa
gaaacaggtgaggaaaagaccattatttttaatttaagcggtcacggactcatggatctt
aacggatatgccaaatatatggcaggtgatcttcataatatttcaatgtctgagaaagaa
attgaagaatcaagaaaaataagtatgggtggaaatcctgttcctaaaatttag

DBGET integrated database retrieval system